1TF5: Preprotein translocase secA subunit

Crystal structure of SecA in an open conformation from Bacillus Subtilis. Determined by X-ray diffraction at 2.18 Å resolution. Released 3 Aug 2004.

Method: X-ray diffraction
Resolution: 2.18 Å
Organism: Bacillus subtilis
Chains: 1
Atoms: 6,316
Mol. weight: 95.96 kDa
Released: 3 Aug 2004

Explore 1TF5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TF5 contains 43 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	1-6	6
α-helix	18-28	11
α-helix	31-34	4
α-helix	38-53	16
α-helix	58-77	20
α-helix	83-93	11
β-strand	97-99	3	1
α-helix	106-118	13
β-strand	124-128	5	1
α-helix	131-147	17
β-strand	152-154	3	1
α-helix	161-169	9
β-strand	172-176	5	1
α-helix	177-187	11
α-helix	193-195	3
α-helix	198-200	3
β-strand	203-207	5	1
α-helix	209-210	2
α-helix	211-215	5
β-strand	220-228	9	2
α-helix	232-241	10
β-strand	250	1	3
β-strand	261	1	3
α-helix	263-272	10
α-helix	281-283	3
α-helix	284-298	15
β-strand	302	1	4
β-strand	306-309	4	4
β-strand	312-315	4	4
β-strand	316	1	5
β-strand	323	1	5
α-helix	333-340	8
α-helix	347-348	2
β-strand	349-356	8	2
α-helix	357-361	5
β-strand	366-371	6	1
α-helix	375-377	3
α-helix	378-385	8
β-strand	389-391	3	1
α-helix	392-394	3
β-strand	401-402	2	6
α-helix	403-405	3
β-strand	406-408	3	7
α-helix	411-428	18
β-strand	432-436	5	6
α-helix	439-450	12
β-strand	457-459	3	6
α-helix	464-471	8
β-strand	480-484	5	6
α-helix	494-496	3
α-helix	500-502	3
β-strand	505-509	5	6
α-helix	516-523	8
α-helix	528-530	3
β-strand	533-537	5	6
β-strand	538-540	3	7
α-helix	545-547	3
α-helix	550-561	12
β-strand	569	1	7
α-helix	572-618	47
α-helix	624-641	18
α-helix	657-662	6
α-helix	667	1
α-helix	681-697	17
α-helix	698-702	5
α-helix	707-736	30
α-helix	738-740	3
α-helix	748-776	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Preprotein translocase secA subunit	A	protein	844	Bacillus subtilis	P28366 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TF5_1 Preprotein translocase secA subunit (chains A)
GPHMLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGAT
TDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLN
ALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTN
NELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQAAKSTKLYVQA
NAFVRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAH
VAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITF
QNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKA
VAEDVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQK
GAVTIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQF
YLSMEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLL
QYDDVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGL
VDLINTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVL
RAVDSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMK
AEIENNLEREEVVQGQTTAHQPQEGDDNKKAKKAPVRKVVDIGRNAPCHCGSGKKYKNCC
GRTE

Primary citation

A large conformational change of the translocation ATPase SecA. Osborne, A.R., Clemons Jr., W.M., Rapoport, T.A. Proc Natl Acad Sci U S A (2004) 101:10937-10942. DOI 10.1073/pnas.0401742101 · PubMed

Other PDB entries of the same protein (UniProt P28366 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JV2 2.5 Å, Crystal Structure of B. subtilis SecA with bound peptide
1M6N 2.7 Å, Crystal structure of the SecA translocation ATPase from Bacillus subtilis
1TF2 2.9 Å, Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
1M74 3.0 Å, Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis
2IBM 3.2 Å, A novel dimer interface and conformational changes revealed by an X-ray structure of B.…
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
3IQY 3.3 Å, Active site mutants of B. subtilis SecA
7XHB 3.33 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP
7XHA 3.35 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP.BeF3-.
3IQM 3.4 Å, Active site mutants of B. subtilis SecA
8Y9Z 3.41 Å, Structure of the SecA-SecY complex with the substrate HmBRI-3TM

Browse structure collections

About this viewer

MolViewer shows 1TF5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.