1MBM: NSP4 proteinase from Equine Arteritis Virus

NSP4 proteinase from Equine Arteritis Virus. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Oct 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Equine arteritis virus
Chains: 4
Atoms: 5,997
Mol. weight: 81.51 kDa
Released: 23 Oct 2002

Explore 1MBM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MBM contains 29 α-helices and 79 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	20-28	9	1
β-strand	31-37	7	1
α-helix	38-41	4
β-strand	46-51	6	1
β-strand	54-59	6	1
β-strand	61-63	3	1
β-strand	66-71	6	1
α-helix	80-81	2
β-strand	82	1	1
α-helix	83	1
β-strand	85	1	2
β-strand	91-98	8	2
β-strand	100-106	7	2
β-strand	111-112	2	2
α-helix	117-119	3
β-strand	123-126	4	2
β-strand	129-138	10	2
α-helix	139-141	3
β-strand	142-146	5	2
α-helix	151	1
β-strand	152-153	2	2
β-strand	158-159	2	3
α-helix	160-164	5
β-strand	171-173	3	4
α-helix	174-175	2
β-strand	182-183	2	3
β-strand	188-190	3	4
α-helix	191-198	8

Chain B: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	5
β-strand	20-27	8	5
β-strand	32-37	6	5
α-helix	38-41	4
β-strand	46-51	6	5
β-strand	54-63	10	5
β-strand	66-71	6	5
α-helix	80-81	2
β-strand	82	1	5
α-helix	83	1
β-strand	85	1	6
β-strand	91-97	7	6
β-strand	100-106	7	6
β-strand	111-112	2	6
β-strand	123-126	4	6
β-strand	129-138	10	6
β-strand	142-146	5	6
β-strand	152-153	2	6
β-strand	158-159	2	7
α-helix	160-164	5
β-strand	171-173	3	8
α-helix	174-175	2
β-strand	182-183	2	7
β-strand	188-190	3	8
α-helix	191-196	6

Chain C: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	9
β-strand	20-27	8	9
β-strand	32-37	6	9
α-helix	38-41	4
β-strand	46-51	6	9
β-strand	54-59	6	9
β-strand	61-63	3	9
β-strand	66-71	6	9
α-helix	80-81	2
β-strand	82	1	9
α-helix	83	1
β-strand	85	1	10
β-strand	91-97	7	10
β-strand	100-106	7	10
β-strand	111-112	2	10
α-helix	117-119	3
β-strand	123-126	4	10
β-strand	129-138	10	10
β-strand	142-146	5	10
β-strand	152-153	2	10
β-strand	158-159	2	11
α-helix	160-164	5
β-strand	171-173	3	12
α-helix	174-175	2
β-strand	182-183	2	11
β-strand	188-190	3	12
α-helix	191-196	6

Chain D: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	13
β-strand	20-28	9	13
β-strand	31-37	7	13
α-helix	38-41	4
β-strand	46-51	6	13
β-strand	54-59	6	13
β-strand	61-63	3	13
β-strand	66-71	6	13
α-helix	80-81	2
β-strand	82	1	13
α-helix	83	1
β-strand	85	1	14
β-strand	91-97	7	14
β-strand	100-106	7	14
β-strand	111-112	2	14
α-helix	117-119	3
β-strand	123-126	4	14
β-strand	129-138	10	14
β-strand	142-146	5	14
β-strand	152-153	2	14
β-strand	158-159	2	15
α-helix	160-164	5
β-strand	171-173	3	16
α-helix	174-175	2
β-strand	182-183	2	15
β-strand	188-190	3	16
α-helix	191-197	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
chymotrypsin-like serine protease	A, B, C, D	protein	198	Equine arteritis virus	P19811 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1MBM_1 chymotrypsin-like serine protease (chains A, B, C, D)
KARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDF
AEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQ
GDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADV
DAVPRSLAMLIDGLSNRE

Primary citation

Structure of Arterivirus nsp4: the smallest chymotrypsin-like proteinase with an alpha/beta C-terminal extension and alternate conformations of the oxyanion hole. Barrette-Ng, I.H., Ng, K.K.-S., Mark, B.L. et al. J Biol Chem (2002) 277:39960-39966. DOI 10.1074/jbc.M206978200 · PubMed

Other PDB entries of the same protein (UniProt P19811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
4N0N 2.0 Å, Crystal structure of Arterivirus nonstructural protein 10 (helicase)
4N0O 2.65 Å, Complex structure of Arterivirus nonstructural protein 10 (helicase) with DNA
5HBZ 3.1 Å, Structure of EAV NSP11 K170A mutant at 3.10A
5HC1 3.1 Å, Structure of EAV NSP11 H141A mutant at 3.10A
5F17 3.2 Å, Structure of EAV NSP11 K170A mutant at 3.19A
2L8K NMR Structure of the Arterivirus nonstructural protein 7 alpha (nsp7 alpha)

Browse structure collections

About this viewer

MolViewer shows 1MBM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.