2L8K: Arterivirus nonstructural protein 7 alpha

NMR Structure of the Arterivirus nonstructural protein 7 alpha (nsp7 alpha). Determined by solution NMR. Released 6 Jul 2011.

Method: Solution NMR
Organism: Equine arteritis virus
Chains: 1
Atoms: 942
Mol. weight: 13.49 kDa
Released: 6 Jul 2011

Explore 2L8K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L8K contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
β-strand	25-27	3	1
β-strand	28	1	2
β-strand	31	1	2
α-helix	38-54	17
α-helix	58-68	11
β-strand	82-85	4	1
β-strand	93-96	4	1
β-strand	99-108	10	1
β-strand	113-121	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 7	A	protein	123	Equine arteritis virus	P19811 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L8K_1 Non-structural protein 7 (chains A)
GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAAR
SRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVV
KEE

Primary citation

Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}. Manolaridis, I., Gaudin, C., Posthuma, C.C. et al. J Virol (2011) 85:7449-7453. DOI 10.1128/JVI.00255-11 · PubMed

Other PDB entries of the same protein (UniProt P19811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
1MBM 2.0 Å, NSP4 proteinase from Equine Arteritis Virus
4N0N 2.0 Å, Crystal structure of Arterivirus nonstructural protein 10 (helicase)
4N0O 2.65 Å, Complex structure of Arterivirus nonstructural protein 10 (helicase) with DNA
5HBZ 3.1 Å, Structure of EAV NSP11 K170A mutant at 3.10A
5HC1 3.1 Å, Structure of EAV NSP11 H141A mutant at 3.10A
5F17 3.2 Å, Structure of EAV NSP11 K170A mutant at 3.19A

Browse structure collections

About this viewer

MolViewer shows 2L8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.