5HC1: EAV NSP11 H141A mutant

Structure of EAV NSP11 H141A mutant at 3.10A. Determined by X-ray diffraction at 3.1 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Equine arteritis virus Bucyrus
Chains: 4
Atoms: 6,783
Mol. weight: 97.06 kDa
Released: 12 Oct 2016

Explore 5HC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HC1 contains 27 α-helices and 84 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	8-13	6
β-strand	18-19	2	2
β-strand	26-27	2	2
α-helix	32-34	3
β-strand	38-40	3	3
β-strand	47-51	5	3
β-strand	60-62	3	3
β-strand	66-68	3	1
β-strand	71-73	3	1
β-strand	82-88	7	3
β-strand	91-93	3	3
α-helix	94-97	4
β-strand	99	1	4
α-helix	105-107	3
α-helix	115-123	9
α-helix	125-127	3
β-strand	141-142	2	5
β-strand	157	1	6
β-strand	160	1	7
β-strand	162	1	7
β-strand	173	1	6
β-strand	175-176	2	5
α-helix	180-186	7
β-strand	193-200	8	4
β-strand	203-210	8	4
β-strand	214-217	4	4

Chain B: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	8
α-helix	8-13	6
β-strand	18-19	2	9
β-strand	26-27	2	9
α-helix	30-35	6
β-strand	38-40	3	10
β-strand	47-51	5	10
β-strand	60-62	3	10
β-strand	66-68	3	8
β-strand	71-73	3	8
α-helix	74-76	3
β-strand	82-88	7	10
β-strand	91-93	3	10
α-helix	94-97	4
β-strand	99	1	11
α-helix	105-107	3
α-helix	115-123	9
β-strand	126	1	11
β-strand	140-142	3	12
β-strand	157-159	3	12
β-strand	173-176	4	12
α-helix	180-187	8
β-strand	193-200	8	11
β-strand	203-210	8	11
β-strand	215-217	3	11

Chain C: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	13
α-helix	8-14	7
β-strand	18-19	2	14
β-strand	26-27	2	14
α-helix	32-35	4
β-strand	38-40	3	14
β-strand	47-51	5	14
β-strand	60-62	3	14
β-strand	66-68	3	13
β-strand	71-73	3	13
β-strand	82-88	7	14
β-strand	91-93	3	14
α-helix	94-97	4
β-strand	99	1	15
α-helix	104-107	4
α-helix	115-123	9
β-strand	131	1	16
β-strand	136	1	16
β-strand	142	1	17
β-strand	157-159	3	18
β-strand	162-164	3	19
β-strand	168-170	3	19
β-strand	173-175	3	18
β-strand	176	1	17
α-helix	180-186	7
β-strand	193-200	8	15
β-strand	203-210	8	15
β-strand	214-217	4	15

Chain D: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	20
α-helix	8-12	5
β-strand	18-19	2	21
β-strand	26-27	2	21
α-helix	32-35	4
β-strand	38-40	3	21
β-strand	47-51	5	21
β-strand	60-62	3	21
β-strand	66-68	3	20
β-strand	71-73	3	20
α-helix	74-76	3
β-strand	82-87	6	21
β-strand	92-93	2	21
β-strand	99	1	22
β-strand	101	1	23
α-helix	104-107	4
α-helix	115-123	9
α-helix	125-129	5
β-strand	132	1	24
β-strand	137	1	24
β-strand	142	1	25
β-strand	157-159	3	26
β-strand	162-164	3	27
β-strand	168-170	3	27
β-strand	173-175	3	26
β-strand	176	1	25
β-strand	178	1	23
α-helix	180-186	7
β-strand	193-200	8	22
β-strand	203-210	8	22
β-strand	214-218	5	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 11	A, B, C, D	protein	221	Equine arteritis virus Bucyrus	P19811 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5HC1_1 Non-structural protein 11 (chains A, B, C, D)
AGSNKISCLPRVAQNLGYHYSPDLPGFCPIPKELAEHWPVVSNDRYPNCLQITLQQVCEL
SKPCSAGYMVGQSVFVQTPGVTSYWLTEWVDGKARALPDSLFSSGRFETNSRAFLDEAEE
KFAAAHPHACLGEINKSTVGGSAFIFSQYLPPLLPADAVALVGASLAGKAAKAACSVVDV
YAPSFEPYLHPETLSRVYKIMIDFKPCRLMVWRNATFYVQE

Primary citation

Structural Biology of the Arterivirus nsp11 Endoribonucleases. Zhang, M., Li, X., Deng, Z. et al. J Virol (2017) 91. DOI 10.1128/JVI.01309-16 · PubMed

Other PDB entries of the same protein (UniProt P19811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IUM 1.45 Å, Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
1MBM 2.0 Å, NSP4 proteinase from Equine Arteritis Virus
4N0N 2.0 Å, Crystal structure of Arterivirus nonstructural protein 10 (helicase)
4N0O 2.65 Å, Complex structure of Arterivirus nonstructural protein 10 (helicase) with DNA
5HBZ 3.1 Å, Structure of EAV NSP11 K170A mutant at 3.10A
5F17 3.2 Å, Structure of EAV NSP11 K170A mutant at 3.19A
2L8K NMR Structure of the Arterivirus nonstructural protein 7 alpha (nsp7 alpha)

Browse structure collections

About this viewer

MolViewer shows 5HC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.