The refined 1.6 Å resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family. Determined by X-ray diffraction at 1.6 Å resolution. Released 31 Jan 1994.
Explore 1MCT in 3D Show helices and sheets RCSB PDB PDBe
1MCT contains 9 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-34 | 5 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 64-67 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 128-130 | 3 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 4 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-201 | 4 | 2 |
| β-strand | 204-216 | 9 | 2 |
| β-strand | 221 | 1 | 5 |
| β-strand | 224 | 1 | 5 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-233 | 3 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 2 |
| β-strand | 9 | 1 | 6 |
| α-helix | 13-15 | 3 | |
| β-strand | 22-23 | 2 | 6 |
| β-strand | 26-27 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-trypsin | A | protein | 223 | Sus scrofa | P00761 (AlphaFold model) |
| Trypsin inhibitor a | I | protein | 28 | Momordica charantia | P30709 (AlphaFold model) |
>1MCT_1 BETA-TRYPSIN (chains A) IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEG NEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISG WGNTKSSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGP VVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
>1MCT_2 TRYPSIN INHIBITOR A (chains I) RICPRIWMECTRDSDCMAKCICVAGHCG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Refined 1.6 A resolution crystal structure of the complex formed between porcine beta-trypsin and MCTI-A, a trypsin inhibitor of the squash family. Detailed comparison with bovine beta-trypsin and its complex. Huang, Q., Liu, S., Tang, Y. J Mol Biol (1993) 229:1022-1036. DOI 10.1006/jmbi.1993.1102 · PubMed
Other PDB entries of the same protein (UniProt P00761 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.