9PCT: Porcine Trypsin Crystals Grown from PEG

Structure of Porcine Trypsin Crystals Grown from PEG Complexed with Crystallization Additives III. Determined by X-ray diffraction at 1.41 Å resolution. Released 17 Sept 2025.

Method: X-ray diffraction
Resolution: 1.41 Å
Organism: Sus scrofa
Chains: 1
Atoms: 2,252
Mol. weight: 30.14 kDa
Ligands: BEN, FLC, PG5, MLT
Released: 17 Sept 2025

Explore 9PCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PCT contains 9 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	5-6	2	2
α-helix	7-8	2
β-strand	15-19	5	3
β-strand	23-31	9	3
β-strand	34-37	4	3
α-helix	39-41	3
β-strand	47-50	4	3
β-strand	54	1	4
β-strand	63-72	10	3
β-strand	86-90	5	3
α-helix	93-96	4
β-strand	104	1	2
α-helix	105-106	2
α-helix	109-111	3
β-strand	115-120	6	2
β-strand	134	1	4
β-strand	136-142	7	2
α-helix	143-144	2
α-helix	145-151	7
β-strand	160-163	4	2
β-strand	171	1	1
β-strand	180-183	4	2
β-strand	186-193	8	2
β-strand	204-208	5	2
α-helix	209-212	4
α-helix	213-222	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin	A	protein	231	Sus scrofa	P00761 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9PCT_1 Trypsin (chains A)
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE
HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA
GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS
CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN

Ligands and cofactors

ID	Name	Formula	Copies
BEN	Benzamidine	C7 H8 N2	3
FLC	Citrate anion	C6 H5 O7	2
PG5	1-methoxy-2-[2-(2-methoxy-ethoxy]-ethane	C8 H18 O4	5
MLT	D-malate	C4 H6 O5	3
PG6	1-(2-methoxy-ethoxy)-2-{2-[2-(2-methoxy-ethoxy]-ethoxy}-ethane	C12 H26 O6	2
PO4	Phosphate ion	O4 P	1
TAR	D(-)-tartaric acid	C4 H6 O6	1
CA	Calcium ion	Ca	1

Water and common crystallization additives (PG4, PEG, GOL, EPE, ACT) are not listed.

Primary citation

X-ray Diffraction Analyses of Trypsin Crystals Grown in the Presence of Additives. McPherson, A. Cryst Growth Des (2026) 26:352-364. DOI 10.1021/acs.cgd.5c01305

Other PDB entries of the same protein (UniProt P00761 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PDA 1.18 Å, Structure of Porcine Trypsin Crystals Grown From PEG and Complexed With Crystallization…
1S83 1.25 Å, Porcine trypsin complexed with 4-amino propanol
2A31 1.25 Å, Trypsin in complex with borate
9PDC 1.27 Å, Porcine Trypsin grown from PEG and Complexed with Crystallization Additives II
9PD9 1.28 Å, The Structure of Porcine Trypsin in Complex with Crystallization Additives I
1S5S 1.4 Å, Porcine trypsin complexed with guanidine-3-propanol inhibitor
1S6H 1.45 Å, Porcine trypsin complexed with guanidine-3-propanol inhibitor
1H9H 1.5 Å, Complex of eeti-II with porcine trypsin
2A32 1.5 Å, Trypsin in complex with benzene boronic acid
1FNI 1.6 Å, Crystal structure of porcine beta trypsin with 0.01% polydocanol
1MCT 1.6 Å, The refined 1.6 Å resolution crystal structure of the complex formed between porcine…
1QQU 1.63 Å, Crystal structure of porcine beta trypsin with bound acetate ion

Browse structure collections

About this viewer

MolViewer shows 9PCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.