1MFQ: Signal recognition particle 19kDa protein

Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle. Determined by X-ray diffraction at 3.1 Å resolution. Released 20 Sept 2002.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,503
Mol. weight: 69.05 kDa
Ligands: MG
Released: 20 Sept 2002

Explore 1MFQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MFQ contains 13 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	1
α-helix	20-23	4
β-strand	24	1	2
β-strand	41	1	2
α-helix	46-53	8
α-helix	54-56	3
β-strand	59-63	5	1
β-strand	81-85	5	1
β-strand	87	1	3
β-strand	93	1	3
α-helix	102-111	10
α-helix	112-114	3
α-helix	116-119	4

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	329-338	10
α-helix	343-347	5
α-helix	366-379	14
α-helix	384-387	4
α-helix	392-398	7
α-helix	401-409	9
α-helix	414-433	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
7S RNA of human SRP	A	RNA	128	Homo sapiens
signal recognition particle 19kDa protein	B	protein	108	Homo sapiens	P09132 (AlphaFold model)
signal recognition particle 54kDa protein	C	protein	129	Homo sapiens	P61011 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MFQ_1 7S RNA of human SRP (chains A)
GACACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCU
AAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCA
GUAGUGUC

Sequence of entity 2 (B), FASTA

>1MFQ_2 signal recognition particle 19kDa protein (chains B)
MRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREW
NRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ

Sequence of entity 3 (C), FASTA

>1MFQ_3 signal recognition particle 54kDa protein (chains C)
MRGSHHHHHHKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARL
KKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK
KMGGIKGLF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5

Water and common crystallization additives (CL) are not listed.

Primary citation

Induced structural changes of 7SL RNA during the assembly of human signal recognition particle. Kuglstatter, A., Oubridge, C., Nagai, K. Nat Struct Biol (2002) 9:740-744. DOI 10.1038/nsb843 · PubMed

Other PDB entries of the same protein (UniProt P09132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JID 1.8 Å, Human SRP19 in complex with helix 6 of Human SRP RNA
7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain
4P3E 3.5 Å, Structure of the human SRP S domain
3KTV 3.8 Å, Crystal structure of the human SRP19/S-domain SRP RNA complex
2J37 8.7 Å, Model of mammalian srp bound to 80S rncs
1RY1 12.0 Å, Structure of the signal recognition particle interacting with the elongation-arrested…

Browse structure collections

About this viewer

MolViewer shows 1MFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.