3KTV: Human SRP19/S-domain SRP RNA complex

Crystal structure of the human SRP19/S-domain SRP RNA complex. Determined by X-ray diffraction at 3.8 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,390
Mol. weight: 100.03 kDa
Ligands: MG
Released: 16 Feb 2010

Explore 3KTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KTV contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	16-18	3	1
α-helix	20-23	4
β-strand	24	1	2
β-strand	41	1	2
α-helix	46-54	9
β-strand	59-62	4	1
α-helix	76-78	3
β-strand	82-85	4	1
β-strand	87-88	2	3
β-strand	92-93	2	3
α-helix	101-111	11

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	4
α-helix	20-23	4
β-strand	24	1	5
α-helix	37-39	3
β-strand	41	1	5
α-helix	46-54	9
β-strand	59-62	4	4
α-helix	76-78	3
β-strand	82-85	4	4
β-strand	87-88	2	6
β-strand	92-93	2	6
α-helix	101-111	11
α-helix	112-114	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Srp RNA	A	RNA	108	Homo sapiens
Signal recognition particle 19 kDa protein	B, D	protein	128	Homo sapiens	P09132 (AlphaFold model)
Srp RNA	C	RNA	108	Homo sapiens

Sequence of entity 1 (A), FASTA

>3KTV_1 SRP RNA (chains A)
GCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGU
GAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGUA

Sequence of entity 2 (B, D), FASTA

>3KTV_2 Signal recognition particle 19 kDa protein (chains B, D)
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
LEHHHHHH

Sequence of entity 3 (C), FASTA

>3KTV_3 SRP RNA (chains C)
GCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGU
GAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGUA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Water and common crystallization additives (K) are not listed.

Primary citation

Structural insights into the assembly of the human and archaeal signal recognition particles. Wild, K., Bange, G., Bozkurt, G. et al. Acta Crystallogr D Biol Crystallogr (2010) 66:295-303. DOI 10.1107/S0907444910000879 · PubMed

Other PDB entries of the same protein (UniProt P09132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JID 1.8 Å, Human SRP19 in complex with helix 6 of Human SRP RNA
7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
1MFQ 3.1 Å, Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition…
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain
4P3E 3.5 Å, Structure of the human SRP S domain
2J37 8.7 Å, Model of mammalian srp bound to 80S rncs
1RY1 12.0 Å, Structure of the signal recognition particle interacting with the elongation-arrested…

Browse structure collections

About this viewer

MolViewer shows 3KTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.