1MHD: Smad MH1 domain

Crystal structure of a smad MH1 domain bound to DNA. Determined by X-ray diffraction at 2.8 Å resolution. Released 18 Aug 1999.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,614
Mol. weight: 39.33 kDa
Released: 18 Aug 1999

Explore 1MHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MHD contains 12 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7
α-helix	26-45	20
α-helix	48-57	10
α-helix	63-64	2
β-strand	66-68	3	1
β-strand	75-78	4	2
β-strand	80-82	3	2
α-helix	84-92	9
β-strand	103-105	3	3
β-strand	119-121	3	1
α-helix	124-126	3
β-strand	127-129	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA	C	DNA	13
DNA	D	DNA	14
SMAD3	A, B	protein	132	Homo sapiens	P84022 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1MHD_1 DNA (chains C)
CAGTCTAGACATA

Sequence of entity 2 (D), FASTA

>1MHD_2 DNA (chains D)
TATGTCTAGACTGA

Sequence of entity 3 (A, B), FASTA

>1MHD_3 SMAD3 (chains A, B)
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVET

Primary citation

Crystal structure of a Smad MH1 domain bound to DNA: insights on DNA binding in TGF-beta signaling. Shi, Y., Wang, Y.F., Jayaraman, L. et al. Cell (1998) 94:585-594. DOI 10.1016/S0092-8674(00)81600-1 · PubMed

Other PDB entries of the same protein (UniProt P84022 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIB 1.7 Å, 14-3-3 sigma in complex with SMAD3 pS423 peptide
1MJS 1.91 Å, MH2 domain of transcriptional factor SMAD3
5OD6 2.0 Å, Crystal structure of Smad3-MH1 bound to the GGCGC site.
5ODG 2.12 Å, Crystal structure of Smad3-MH1 bound to the GGCT site.
6ZMN 2.33 Å, Crystal structure of the Smad3-Smad5 MH1 domain chimera bound to the GGCGC site
1OZJ 2.4 Å, Crystal structure of Smad3-MH1 bound to DNA at 2.4 A resolution
5XOC 2.4 Å, Crystal structure of human Smad3-FoxH1 complex
1U7F 2.6 Å, Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
1MK2 2.74 Å, SMAD3 SBD complex
2LAJ Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3…
2LB2 Structure of the second domain of human Nedd4L in complex with a phosphorylated pTPY…

Browse structure collections

About this viewer

MolViewer shows 1MHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.