2LB2: Second domain of human Nedd4L

Structure of the second domain of human Nedd4L in complex with a phosphorylated pTPY motif derived from human Smad3. Determined by solution NMR. Released 6 Jul 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 388
Mol. weight: 5.53 kDa
Released: 6 Jul 2011

Explore 2LB2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LB2 contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	369	1	1
β-strand	371-376	6	1
β-strand	380-385	6	1
β-strand	390-392	3	1
α-helix	395-396	2
α-helix	397-399	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	179-183	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4-like	A	protein	35	Homo sapiens	Q96PU5 (AlphaFold model)
Mothers against decapentaplegic homolog 3	B	protein	12	Homo sapiens	P84022 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LB2_1 E3 ubiquitin-protein ligase NEDD4-like (chains A)
GLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL

Sequence of entity 2 (B), FASTA

>2LB2_2 Mothers against decapentaplegic homolog 3 (chains B)
ETPPPGYLSEDG

Primary citation

A Smad action turnover switch operated by WW domain readers of a phosphoserine code. Aragon, E., Goerner, N., Zaromytidou, A.I. et al. Genes Dev (2011) 25:1275-1288. DOI 10.1101/gad.2060811 · PubMed

Other PDB entries of the same protein (UniProt Q96PU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LP1 1.35 Å, Structure of Nedd4L WW3 domain
7LP3 1.61 Å, Structure of Nedd4L WW3 domain
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
2NSQ 1.85 Å, Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like…
7LP2 1.88 Å, Structure of Nedd4L WW3 domain
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
2ONI 2.2 Å, Catalytic Domain of the Human NEDD4-like E3 Ligase
7NMZ 2.3 Å, Structure of 14-3-3 eta in complex with Nedd4-2(335-455) containing two 14-3-3 binding…
5HPK 2.43 Å, System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes:…
9Z5Q 3.06 Å, HECT domain of NEDD4-2 complex with a targeted nanobody, nb.C11
3JW0 3.1 Å, E2~Ubiquitin-HECT
3JVZ 3.3 Å, E2~Ubiquitin-HECT

Browse structure collections

About this viewer

MolViewer shows 2LB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.