1MIX: FERM domain of Talin

Crystal structure of a FERM domain of Talin. Determined by X-ray diffraction at 1.75 Å resolution. Released 28 Jan 2003.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Gallus gallus
Chains: 1
Atoms: 1,853
Mol. weight: 23.89 kDa
Released: 28 Jan 2003

Explore 1MIX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MIX contains 13 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	196-200	5
α-helix	201-205	5
α-helix	209-224	16
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-270	3
α-helix	276-285	10
α-helix	291-304	14
β-strand	311-317	7	1
α-helix	318-319	2
β-strand	326-332	7	1
β-strand	336-341	6	1
β-strand	347-352	6	1
α-helix	353-355	3
β-strand	358-361	4	1
β-strand	365-369	5	1
α-helix	371-373	3
β-strand	378-381	4	1
α-helix	385-393	9
α-helix	397-399	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin	A	protein	206	Gallus gallus	P54939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MIX_1 Talin (chains A)
MKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQK
HKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFL
VKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ
DGYYSVQTTEGEQIAQLIAGYIDIIL

Primary citation

Structural determinants of integrin recognition by talin. Garcia-Alvarez, B., de Pereda, J.M., Calderwood, D.A. et al. Mol Cell (2003) 11:49-58. DOI 10.1016/S1097-2765(02)00823-7 · PubMed

Other PDB entries of the same protein (UniProt P54939 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
1RKC 2.7 Å, Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues…
8S4Y 2.7 Å, Crystal structure of an APP-talin (F2F3) chimera
1MK9 2.8 Å, Crystal structure of an integrin BETA3-talin chimera
2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
2H7E Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
2HRJ NMR solution structure of the F2 subdomain of talin

Browse structure collections

About this viewer

MolViewer shows 1MIX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.