2HRJ: F2 subdomain of talin

NMR solution structure of the F2 subdomain of talin. Determined by solution NMR. Released 29 Apr 2008.

Method: Solution NMR
Organism: Gallus gallus
Chains: 1
Atoms: 997
Mol. weight: 14.18 kDa
Released: 29 Apr 2008

Explore 2HRJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HRJ contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	15-18	4
α-helix	21-37	17
α-helix	44-58	15
α-helix	74-76	3
α-helix	80-85	6
α-helix	88-98	11
α-helix	103-117	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	121	Gallus gallus	P54939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HRJ_1 Talin-1 (chains A)
ETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFG
PHNEQKHKPGFLELKDFLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTY
G

Primary citation

Structural characterization of the talin F2 FERM subdomain with Coenzyme A and PI(4,5)P2. Arroyo, M.M., Liu, G., Guibao, C.D. et al. To be published.

Other PDB entries of the same protein (UniProt P54939 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MIX 1.75 Å, Crystal structure of a FERM domain of Talin
1ZVZ 1.8 Å, Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844
1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
1ZW2 2.1 Å, Vinculin Head (0-258) in Complex with the Talin Rod residues 2345-2369
1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
1U6H 2.38 Å, Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
1XWJ 2.6 Å, Vinculin head (1-258) in complex with the talin vinculin binding site 3 (1945-1969)
1RKC 2.7 Å, Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues…
8S4Y 2.7 Å, Crystal structure of an APP-talin (F2F3) chimera
1MK9 2.8 Å, Crystal structure of an integrin BETA3-talin chimera
2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…
2H7E Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP…

Browse structure collections

About this viewer

MolViewer shows 2HRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.