1MK9: Integrin BETA3-talin chimera
Crystal structure of an integrin BETA3-talin chimera. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 Jan 2003.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organisms
- Homo sapiens, Gallus gallus
- Chains
- 8
- Atoms
- 6,640
- Mol. weight
- 95.95 kDa
- Released
- 28 Jan 2003
Explore 1MK9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1MK9 contains 30 α-helices and 35 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C and G: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 740-741 | 2 | 1 |
Chain B: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 268-270 | 3 | |
| α-helix | 276-285 | 10 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-316 | 6 | 2 |
| β-strand | 327-333 | 7 | 2 |
| β-strand | 336-341 | 6 | 2 |
| β-strand | 347-352 | 6 | 2 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 2 |
| β-strand | 365-369 | 5 | 2 |
| β-strand | 377-381 | 5 | 2 |
| α-helix | 385-397 | 13 | |
Chain D: 8 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-271 | 4 | |
| α-helix | 276-284 | 9 | |
| α-helix | 291-303 | 13 | |
| β-strand | 313-317 | 5 | 3 |
| β-strand | 326-332 | 7 | 3 |
| β-strand | 336-341 | 6 | 3 |
| β-strand | 347-352 | 6 | 3 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 1 |
| β-strand | 365-372 | 8 | 1 |
| β-strand | 376-380 | 5 | 1 |
| β-strand | 381 | 1 | 3 |
| α-helix | 385-396 | 12 | |
Chain E: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 739-741 | 3 | 4 |
Chain F: 8 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-246 | 15 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 277-285 | 9 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-315 | 5 | 5 |
| β-strand | 318 | 1 | 6 |
| β-strand | 325 | 1 | 6 |
| β-strand | 328-333 | 6 | 5 |
| β-strand | 336-340 | 5 | 5 |
| β-strand | 347-352 | 6 | 5 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-362 | 5 | 7 |
| β-strand | 365-369 | 5 | 7 |
| β-strand | 378-381 | 4 | 7 |
| α-helix | 385-395 | 11 | |
Chain H: 7 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 210-224 | 15 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 276-284 | 9 | |
| α-helix | 293-303 | 11 | |
| β-strand | 311-317 | 7 | 4 |
| β-strand | 326-333 | 8 | 4 |
| β-strand | 336-340 | 5 | 4 |
| β-strand | 347-352 | 6 | 4 |
| β-strand | 358-361 | 4 | 4 |
| β-strand | 365-369 | 5 | 4 |
| β-strand | 377-381 | 5 | 4 |
| α-helix | 385-398 | 14 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Integrin Beta3 | A, C, E, G | protein | 16 | Homo sapiens | P05106 (AlphaFold model) |
| Talin | B, D, F, H | protein | 192 | Gallus gallus | P54939 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>1MK9_1 Integrin Beta3 (chains A, C, E, G)
GSHMWDTANNPLYKEA
Sequence of entity 2 (B, D, F, H), FASTA
>1MK9_2 TALIN (chains B, D, F, H)
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPK
EYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPR
LLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQI
AQLIAGYIDIIL
Primary citation
Structural Determinants of Integrin Recognition by Talin. Garcia-Alvarez, B., de Pereda, J.M., Calderwood, D.A. et al. Mol Cell (2003) 11:49-58. DOI 10.1016/S1097-2765(02)00823-7 · PubMed
Other PDB entries of the same protein (UniProt P05106 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
- 7UDH 2.0 Å, Integrin alpha IIB beta3 complex with BMS4-3
- 4HXJ 2.0 Å, Crystal structure of SH3:RGT complex
- 7UBR 2.05 Å, Integrin alpha IIB beta3 complex with GR144053
- 6BXJ 2.09 Å, Structure of a single-chain beta3 integrin
- 1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
- 3T3P 2.2 Å, A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly…
- 7TMZ 2.2 Å, Integrin alpha IIB beta3 complex with BMS compound 4
- 2Q6W 2.25 Å, The structure of HLA-DRA, DRB3*0101 (DR52a) with bound platelet integrin peptide…
- 3NIG 2.25 Å, The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific…
- 7U9V 2.25 Å, Integrin alpha IIB beta3 complex with BMS4-1
- 3NID 2.3 Å, The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3…
Browse structure collections
About this viewer
MolViewer shows 1MK9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.