1MKF: PDB entry 1MKF

Viral chemokine binding protein M3 from murine gammaherpesvirus 68. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Nov 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Murid herpesvirus 4
Chains: 2
Atoms: 6,038
Mol. weight: 83.65 kDa
Released: 13 Nov 2002

Explore 1MKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MKF contains 27 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	1
α-helix	29-36	8
α-helix	45-57	13
α-helix	61-65	5
β-strand	68-75	8	1
β-strand	77-79	3	2
α-helix	80-82	3
β-strand	84-89	6	2
β-strand	104-112	9	1
α-helix	114-116	3
α-helix	119-120	2
α-helix	123-124	2
β-strand	126-131	6	2
β-strand	136-139	4	2
α-helix	141-143	3
β-strand	144-148	5	1
β-strand	151-159	9	1
α-helix	160-162	3
α-helix	167	1
β-strand	168-173	6	2
β-strand	181-189	9	1
β-strand	192-201	10	1
α-helix	206-207	2
β-strand	208	1	1
β-strand	212-216	5	3
α-helix	221-224	4
α-helix	237-239	3
β-strand	244-246	3	4
β-strand	257-260	4	4
α-helix	263-268	6
β-strand	279-285	7	4
α-helix	287-289	3
β-strand	294-301	8	3
β-strand	315-325	11	3
β-strand	328-331	4	3
β-strand	339-343	5	4
β-strand	349-354	6	4
α-helix	356-361	6
β-strand	362-369	8	3
β-strand	372-377	6	3

Chain B: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	5
α-helix	29-35	7
α-helix	45-54	10
α-helix	61-65	5
β-strand	68-75	8	5
β-strand	77-79	3	6
α-helix	80-82	3
β-strand	84-89	6	6
β-strand	104-112	9	5
α-helix	119-120	2
β-strand	126-132	7	6
β-strand	135-139	5	6
α-helix	141-143	3
β-strand	144-148	5	5
β-strand	151-159	9	5
α-helix	160-162	3
β-strand	168-173	6	6
β-strand	181-189	9	5
β-strand	192-201	10	5
α-helix	206-207	2
β-strand	208	1	5
β-strand	212-216	5	7
α-helix	227-229	3
β-strand	244-246	3	8
β-strand	256-260	5	8
α-helix	263-268	6
β-strand	279-285	7	8
β-strand	294-301	8	7
β-strand	315-325	11	7
β-strand	328-331	4	7
β-strand	339-343	5	8
β-strand	349-354	6	8
α-helix	359-361	3
β-strand	362-369	8	7
β-strand	372-377	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M3	A, B	protein	382	Murid herpesvirus 4	O41925 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1MKF_1 M3 (chains A, B)
LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLH
ELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETP
EEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGA
KVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAY
FDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMP
NLVGVSLMLEGQQYRLEYFGDH

Primary citation

Structural Basis of Chemokine Sequestration by a Herpesvirus Decoy Receptor. Alexander, J.M., Nelson, C.A., Van Berkel, V. et al. Cell (2002) 111:343-356. DOI 10.1016/S0092-8674(02)01007-3 · PubMed

Other PDB entries of the same protein (UniProt O41925 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NZ1 2.5 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The…
2NYZ 2.6 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C-…
1ML0 2.8 Å, Viral chemokine binding protein M3 from murine GAMMAHERPESVIRUS68 in complex with the…

Browse structure collections

About this viewer

MolViewer shows 1MKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.