Viral chemokine binding protein M3 from murine GAMMAHERPESVIRUS68 in complex with the P8A variant of cc-chemokine mcp-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 13 Nov 2002.
Explore 1ML0 in 3D Show helices and sheets RCSB PDB PDBe
1ML0 contains 11 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15-18 | 4 | 1 |
| α-helix | 23-25 | 3 | |
| α-helix | 29-35 | 7 | |
| α-helix | 45-57 | 13 | |
| α-helix | 61-65 | 5 | |
| β-strand | 68-75 | 8 | 1 |
| β-strand | 77-79 | 3 | 2 |
| β-strand | 84-89 | 6 | 2 |
| β-strand | 104-112 | 9 | 1 |
| β-strand | 127-131 | 5 | 2 |
| β-strand | 136-138 | 3 | 2 |
| β-strand | 144-148 | 5 | 1 |
| β-strand | 151-159 | 9 | 1 |
| α-helix | 160-162 | 3 | |
| β-strand | 165 | 1 | 3 |
| β-strand | 167 | 1 | 3 |
| β-strand | 168-173 | 6 | 2 |
| β-strand | 181-189 | 9 | 1 |
| β-strand | 192-201 | 10 | 1 |
| β-strand | 208 | 1 | 1 |
| β-strand | 212-216 | 5 | 4 |
| α-helix | 221-224 | 4 | |
| α-helix | 230-233 | 4 | |
| β-strand | 244-246 | 3 | 5 |
| β-strand | 256-260 | 5 | 5 |
| α-helix | 263-268 | 6 | |
| β-strand | 273-274 | 2 | 6 |
| β-strand | 279-285 | 7 | 5 |
| β-strand | 294-301 | 8 | 4 |
| β-strand | 315-325 | 11 | 4 |
| β-strand | 328-331 | 4 | 4 |
| β-strand | 339-343 | 5 | 5 |
| β-strand | 349-354 | 6 | 5 |
| α-helix | 359-361 | 3 | |
| β-strand | 362-369 | 8 | 4 |
| β-strand | 372-377 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 6 |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 7 |
| β-strand | 41-45 | 5 | 7 |
| β-strand | 50-53 | 4 | 7 |
| α-helix | 58-68 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| M3 Protein | A | protein | 382 | Murid herpesvirus 4 | O41925 (AlphaFold model) |
| Small Inducible Cytokine | D | protein | 76 | Homo sapiens | P13500 (AlphaFold model) |
>1ML0_1 M3 Protein (chains A) LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLH ELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETP EEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGA KVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAY FDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMP NLVGVSLMLEGQQYRLEYFGDH
>1ML0_2 Small Inducible Cytokine (chains D) QPDAINAAVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWV QDSIDHLDKQTQTPKT
Structural Basis of Chemokine Sequestration by a Herpesvirus Decoy Receptor. Alexander, J.M., Nelson, C.A., van Berkel, V. et al. Cell (2002) 111:343-356. DOI 10.1016/S0092-8674(02)01007-3 · PubMed
Other PDB entries of the same protein (UniProt O41925 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ML0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.