1MQ1: Ca2+-S100B-TRTK-12 complex

Ca2+-S100B-TRTK-12 complex. Determined by solution NMR. Released 25 Dec 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 1,690
Mol. weight: 24.15 kDa
Released: 25 Dec 2002

Explore 1MQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MQ1 contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	2-17	16
α-helix	29-39	11
α-helix	50-60	11
α-helix	70-80	11
α-helix	81-85	5
α-helix	86-87	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-100 protein, beta chain	A, B	protein	91	Homo sapiens	P04271 (AlphaFold model)
F-actin capping protein alpha-1 subunit	C, D	protein	12		P52907 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1MQ1_1 S-100 protein, beta chain (chains A, B)
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETL
DNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Sequence of entity 2 (C, D), FASTA

>1MQ1_2 F-actin capping protein alpha-1 subunit (chains C, D)
TRTKIDWNKILS

Primary citation

A novel S100 target conformation is revealed by the solution structure of the Ca2+-S100B-TRTK-12 complex. McClintock, K.A., Shaw, G.S. J Biol Chem (2003) 278:6251-6257. DOI 10.1074/jbc.M210622200 · PubMed

Other PDB entries of the same protein (UniProt P04271 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D7F 1.3 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
3CZT 1.4 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 9
3D0Y 1.5 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 6.5
3D10 1.65 Å, Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0
2H61 1.9 Å, X-ray structure of human Ca2+-loaded S100B
3HCM 2.0 Å, Crystal structure of human S100B in complex with S45
5CSI 2.13 Å, S100B-RSK1 crystal structure A'
5CSF 2.4 Å, S100B-RSK1 crystal structure A
4XYN 2.55 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W61 peptide
5CSJ 2.7 Å, S100B-RSK1 crystal structure B
5CSN 2.95 Å, S100B-RSK1 crystal structure C
1UWO Calcium form of human S100B, NMR, 20 structures

Browse structure collections

About this viewer

MolViewer shows 1MQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.