1MZW: U-snRNP-associated cyclophilin

Crystal structure of a U4/U6 snRNP complex between human spliceosomal cyclophilin H and a U4/U6-60K peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Aug 2003.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,825
Mol. weight: 22.73 kDa
Released: 19 Aug 2003

Explore 1MZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MZW contains 7 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	7-11	5
β-strand	12-19	8	1
β-strand	22-31	10	1
α-helix	37-48	12
β-strand	52-53	2	2
β-strand	56-57	2	2
β-strand	64	1	1
β-strand	67-69	3	1
β-strand	73-76	4	1
β-strand	95	1	3
β-strand	109-112	4	1
β-strand	120	1	3
β-strand	124-127	4	1
α-helix	132-134	3
β-strand	140-146	7	1
α-helix	148-155	8
β-strand	159	1	4
α-helix	161-163	3
β-strand	165	1	4
β-strand	169-176	8	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	107-113	7
β-strand	119-120	2	1
α-helix	125-135	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U-snRNP-associated cyclophilin	A	protein	177	Homo sapiens	O43447 (AlphaFold model)
U4/U6 snrnp 60kDa protein	B	protein	31		O43172 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MZW_1 U-snRNP-associated cyclophilin (chains A)
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Sequence of entity 2 (B), FASTA

>1MZW_2 U4/U6 snrnp 60kDa protein (chains B)
EVKASLRALGEPITLFGEGPAERRERLRNIL

Primary citation

Crystal structure of a complex between human spliceosomal cyclophilin H and a U4/U6 snRNP-60K peptide. Reidt, U., Wahl, M.C., Fasshauer, D. et al. J Mol Biol (2003) 331:45-56. DOI 10.1016/S0022-2836(03)00684-3 · PubMed

Other PDB entries of the same protein (UniProt O43447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QOI 2.0 Å, U4/U6 snRNP-specific cyclophilin SnuCyp-20
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
6AHD 3.8 Å, The Cryo-EM Structure of Human Pre-catalytic Spliceosome (B complex) at 3.8 angstrom…
8QZS 4.1 Å, Cryo-EM structure of the cross-exon B-like complex
8R09 4.3 Å, Cryo-EM structure of the cross-exon pre-B+5'ss+ATPgammaS complex
8R0B 4.4 Å, Cryo-EM structure of the cross-exon pre-B+ATP complex
5O9Z 4.5 Å, Cryo-EM structure of a pre-catalytic human spliceosome primed for activation (B complex)
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
8RM5 6.9 Å, Cryo-EM structure of the cross-exon pre-B+5'ssLNG+ATPyS complex

Browse structure collections

About this viewer

MolViewer shows 1MZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.