1QOI: U4/U6 snRNP-specific cyclophilin SnuCyp-20

U4/U6 snRNP-specific cyclophilin SnuCyp-20. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Apr 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,504
Mol. weight: 19.23 kDa
Released: 10 Apr 2000

Explore 1QOI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QOI contains 5 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-19	8	1
β-strand	22-31	10	1
α-helix	37-48	12
β-strand	52-53	2	2
β-strand	56-57	2	2
β-strand	64	1	1
β-strand	67-69	3	1
β-strand	73-76	4	1
β-strand	95	1	3
β-strand	109-112	4	1
β-strand	120	1	3
β-strand	124-127	4	1
α-helix	132-134	3
β-strand	140-146	7	1
α-helix	148-155	8
β-strand	159	1	4
α-helix	161-163	3
β-strand	165	1	4
β-strand	169-176	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Snucyp-20	A	protein	177	HOMO SAPIENS	O43447 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QOI_1 SNUCYP-20 (chains A)
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Primary citation

Crystal Structure of the Human U4/U6 Small Nuclear Ribonucleoproteinparticle-Specificsnucyp-20, a Nuclear Cyclophilin. Reidt, U., Reuter, K., Achsel, T. et al. J Biol Chem (2000) 275:7439. DOI 10.1074/JBC.275.11.7439 · PubMed

Other PDB entries of the same protein (UniProt O43447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MZW 2.0 Å, Crystal structure of a U4/U6 snRNP complex between human spliceosomal cyclophilin H and…
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
6AHD 3.8 Å, The Cryo-EM Structure of Human Pre-catalytic Spliceosome (B complex) at 3.8 angstrom…
8QZS 4.1 Å, Cryo-EM structure of the cross-exon B-like complex
8R09 4.3 Å, Cryo-EM structure of the cross-exon pre-B+5'ss+ATPgammaS complex
8R0B 4.4 Å, Cryo-EM structure of the cross-exon pre-B+ATP complex
5O9Z 4.5 Å, Cryo-EM structure of a pre-catalytic human spliceosome primed for activation (B complex)
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
8RM5 6.9 Å, Cryo-EM structure of the cross-exon pre-B+5'ssLNG+ATPyS complex

Browse structure collections

About this viewer

MolViewer shows 1QOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.