1N3Y: Alpha-X beta2 integrin I domain

Crystal structure of the alpha-X beta2 integrin I domain. Determined by X-ray diffraction at 1.65 Å resolution. Released 18 Feb 2003.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,803
Mol. weight: 22.36 kDa
Released: 18 Feb 2003

Explore 1N3Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N3Y contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	131-138	8	1
α-helix	145-159	15
β-strand	167-174	8	1
β-strand	178-182	5	1
α-helix	184-189	6
α-helix	193-197	5
β-strand	207	1	2
α-helix	209-215	7
α-helix	216-220	5
α-helix	223-225	3
β-strand	232-239	8	1
β-strand	244	1	2
α-helix	250-259	10
β-strand	263-269	7	1
α-helix	271-274	4
α-helix	279-285	7
α-helix	287	1
α-helix	291-293	3
β-strand	294-297	4	1
α-helix	300-306	7
α-helix	307-315	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-X	A	protein	198	Homo sapiens	P20702 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N3Y_1 Integrin alpha-X (chains A)
GSHMASRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTH
FTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDG
KKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFD
ALKDIQNQLKEKIFAIEG

Primary citation

Structure and allosteric regulation of the alpha X beta 2 integrin I domain. Vorup-Jensen, T., Ostermeier, C., Shimaoka, M. et al. Proc Natl Acad Sci U S A (2003) 100:1873-1878. DOI 10.1073/pnas.0237387100 · PubMed

Other PDB entries of the same protein (UniProt P20702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NEH 2.75 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
4NEN 2.9 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
5ES4 3.3 Å, Re-refinement of integrin ALPHAXBETA2 ectodomain in the closed/bent conformation
3K6S 3.5 Å, Structure of integrin alphaXbeta2 ectodomain
3K72 3.7 Å, Structure of integrin alphaX beta2
3K71 3.95 Å, Structure of integrin alphaX beta2 ectodomain
2LUV Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin
9ECM Structure of the human integrin alphaX transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 1N3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.