5ES4: Integrin alpha-X

Re-refinement of integrin ALPHAXBETA2 ectodomain in the closed/bent conformation. Determined by X-ray diffraction at 3.3 Å resolution. Released 2 Mar 2016.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 8
Atoms: 51,071
Mol. weight: 847.07 kDa
Ligands: NAG, MG, CA
Released: 2 Mar 2016

Explore 5ES4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ES4 contains 191 α-helices and 535 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 92 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
β-strand	21-25	5	2
β-strand	29-40	12	2
β-strand	43-44	2	2
β-strand	45	1	3
β-strand	46-51	6	2
β-strand	57-59	3	2
β-strand	69	1	4
β-strand	73	1	3
β-strand	76-80	5	4
β-strand	85-97	13	4
β-strand	100-110	11	4
β-strand	117-119	3	4
α-helix	123-126	4
β-strand	131-138	8	5
α-helix	145-159	15
β-strand	167-174	8	5
β-strand	178-182	5	5
α-helix	184-189	6
α-helix	194-198	5
β-strand	207	1	6
α-helix	209-215	7
α-helix	216-220	5
α-helix	223-225	3
β-strand	232-239	8	5
β-strand	244	1	6
α-helix	250-260	11
β-strand	262-269	8	5
α-helix	271-273	3
α-helix	276-285	10
α-helix	287	1
α-helix	290-293	4
β-strand	294-297	4	5
α-helix	303-315	13
β-strand	339	1	7
β-strand	347-350	4	7
α-helix	353-356	4
β-strand	358	1	8
β-strand	359-362	4	7
β-strand	370-372	3	7
α-helix	379-381	3
β-strand	386	1	8
β-strand	389-394	6	9
β-strand	399-405	7	9
α-helix	408-410	3
β-strand	412	1	10
β-strand	413-420	8	9
β-strand	423-431	9	9
β-strand	439	1	10
β-strand	443-446	4	11
β-strand	456-460	5	11
β-strand	465	1	12
β-strand	469-471	3	13
β-strand	473-477	5	11
α-helix	478-479	2
β-strand	489-491	3	11
β-strand	497-502	6	13
β-strand	506-511	6	14
β-strand	518-524	7	14
α-helix	527-530	4
β-strand	532	1	15
β-strand	533-538	6	14
β-strand	539-540	2	16
β-strand	544-545	2	16
β-strand	551-554	4	14
α-helix	555-558	4
β-strand	565	1	15
β-strand	568-573	6	1
β-strand	582-587	6	1
β-strand	590-596	7	1
α-helix	597-598	2
β-strand	599-600	2	17
β-strand	602-609	8	18
β-strand	613	1	19
α-helix	615-618	4
β-strand	621	1	20
β-strand	623	1	20
α-helix	628	1
β-strand	629-639	11	18
β-strand	654-662	9	21
β-strand	672-673	2	18
β-strand	680-687	8	21
β-strand	692-700	9	18
α-helix	710	1
β-strand	711-719	9	21
β-strand	733-734	2	17
β-strand	741-746	6	21
α-helix	747	1
β-strand	748	1	19
α-helix	749	1
β-strand	762-767	6	22
β-strand	774-776	3	23
β-strand	779	1	23
β-strand	781-790	10	22
α-helix	794	1
β-strand	795-796	2	24
β-strand	799-805	7	25
β-strand	808-811	4	22
β-strand	827-834	8	25
β-strand	839-846	8	25
β-strand	849	1	26
β-strand	850-851	2	24
β-strand	856-865	10	22
α-helix	866	1
β-strand	874-882	9	25
β-strand	895-900	6	25
β-strand	901-905	5	23
β-strand	907-911	5	27
β-strand	929-940	12	27
β-strand	946-958	13	28
β-strand	961-962	2	28
β-strand	968-970	3	27
β-strand	980-984	5	28
α-helix	991-996	6
β-strand	1000-1001	2	28
β-strand	1007-1018	12	28
β-strand	1023-1033	11	27
α-helix	1037-1040	4
β-strand	1046-1054	9	28
β-strand	1060-1062	3	23
α-helix	1068-1070	3
β-strand	1071-1077	7	28

Chain B: 28 helices, 56 β-strands

Element	Residues	Length	Sheet
α-helix	11-15	5
β-strand	22-24	3	29
β-strand	31	1	30
β-strand	34	1	30
α-helix	36-39	4
β-strand	40-41	2	29
α-helix	43-48	6
α-helix	53-55	3
β-strand	56-57	2	29
β-strand	62-65	4	31
β-strand	76-77	2	32
β-strand	80-85	6	31
β-strand	91-97	7	32
β-strand	105-112	8	33
α-helix	115-117	3
α-helix	118-124	7
α-helix	128-135	8
β-strand	143-149	7	33
α-helix	162-166	5
β-strand	176	1	34
β-strand	182-189	8	33
α-helix	192-199	8
α-helix	203	1
β-strand	204	1	34
β-strand	212	1	35
α-helix	214-221	8
β-strand	234-241	8	33
β-strand	245	1	35
α-helix	251-254	4
α-helix	258-260	3
β-strand	267	1	33
β-strand	270	1	33
α-helix	273-276	4
α-helix	278-281	4
α-helix	282-291	10
β-strand	294-300	7	33
α-helix	305-309	5
β-strand	319-322	4	33
α-helix	330-341	12
β-strand	345-349	5	31
β-strand	356-360	5	32
β-strand	363	1	32
β-strand	364	1	36
β-strand	368	1	36
β-strand	373	1	32
β-strand	376-378	3	31
β-strand	387-395	9	32
α-helix	399-401	3
β-strand	402-409	8	31
β-strand	414-421	8	31
α-helix	436-439	4
β-strand	441-443	3	37
β-strand	448-450	3	37
β-strand	454-455	2	38
β-strand	461-462	2	38
α-helix	471-473	3
β-strand	481	1	26
α-helix	482	1
α-helix	483-485	3
β-strand	488	1	39
β-strand	491	1	40
β-strand	494	1	40
β-strand	497	1	39
α-helix	498-499	2
β-strand	507-508	2	41
β-strand	514-515	2	41
β-strand	521-522	2	42
β-strand	525-526	2	42
β-strand	533-536	4	43
β-strand	539-542	4	43
α-helix	543	1
β-strand	546-547	2	44
β-strand	553-554	2	44
β-strand	561	1	45
β-strand	567	1	45
β-strand	573-574	2	46
β-strand	579-580	2	46
α-helix	600-603	4
α-helix	604-610	7
α-helix	621-624	4
β-strand	628-630	3	47
β-strand	638-643	6	47
β-strand	649-656	8	47
β-strand	663-667	5	47

Chain C: 14 helices, 81 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	48
β-strand	21-25	5	49
β-strand	29-33	5	49
β-strand	40	1	50
β-strand	43	1	50
β-strand	45	1	51
β-strand	47-51	5	49
β-strand	57-59	3	49
β-strand	69	1	52
β-strand	73	1	51
β-strand	76-80	5	52
β-strand	85-96	12	52
β-strand	101-111	11	52
β-strand	114-119	6	52
β-strand	338-340	3	53
β-strand	347-350	4	53
α-helix	353-356	4
β-strand	358	1	54
β-strand	359-362	4	53
β-strand	370-372	3	53
β-strand	386	1	54
β-strand	389-393	5	55
β-strand	400-405	6	55
α-helix	408-410	3
β-strand	412	1	56
β-strand	413-420	8	55
β-strand	423-431	9	55
β-strand	439	1	56
β-strand	442-446	5	57
β-strand	456-466	11	57
β-strand	469-477	9	57
β-strand	489-491	3	57
β-strand	497-502	6	57
β-strand	505-510	6	58
β-strand	519-524	6	58
α-helix	527-530	4
β-strand	532	1	59
β-strand	533-538	6	58
β-strand	539-540	2	60
β-strand	544-545	2	60
β-strand	552-554	3	58
α-helix	555-558	4
β-strand	565	1	59
β-strand	568-573	6	48
β-strand	582-586	5	48
β-strand	590-595	6	48
α-helix	596-598	3
β-strand	599-600	2	61
β-strand	603-609	7	62
β-strand	613	1	63
α-helix	615-617	3
α-helix	626-628	3
β-strand	629-638	10	62
β-strand	654-662	9	64
β-strand	672-673	2	62
β-strand	680-687	8	64
β-strand	692-700	9	62
β-strand	711-719	9	64
β-strand	733-734	2	61
β-strand	741-746	6	64
α-helix	747	1
β-strand	748	1	63
α-helix	749	1
β-strand	762-767	6	65
β-strand	774-776	3	66
β-strand	779	1	66
β-strand	781-790	10	65
β-strand	795-796	2	67
β-strand	799-805	7	25
β-strand	808-811	4	65
β-strand	828-833	6	25
β-strand	839-845	7	25
β-strand	849	1	68
β-strand	850-851	2	67
β-strand	856-865	10	65
β-strand	874-882	9	25
β-strand	895-900	6	25
β-strand	901-905	5	66
β-strand	907-911	5	69
α-helix	923-925	3
β-strand	929-940	12	69
β-strand	946-958	13	70
β-strand	961-962	2	70
β-strand	964-970	7	69
β-strand	979-984	6	70
α-helix	985-988	4
α-helix	991-997	7
β-strand	1000-1001	2	70
β-strand	1007-1018	12	70
β-strand	1023-1033	11	69
α-helix	1036-1040	5
β-strand	1046-1054	9	70
β-strand	1060-1062	3	66
α-helix	1068-1070	3
β-strand	1071-1077	7	70

Chain D: 27 helices, 47 β-strands

Element	Residues	Length	Sheet
α-helix	11-15	5
β-strand	22-24	3	71
α-helix	36-39	4
β-strand	40-41	2	71
α-helix	43-49	7
α-helix	53-55	3
β-strand	56-57	2	71
α-helix	59-61	3
β-strand	62-65	4	72
β-strand	76-77	2	73
β-strand	80-85	6	72
β-strand	91-97	7	73
β-strand	106-112	7	74
α-helix	115-117	3
α-helix	118-124	7
α-helix	128-135	8
β-strand	143-149	7	74
α-helix	162-166	5
β-strand	182-189	8	74
α-helix	192-199	8
β-strand	212	1	75
α-helix	214-221	8
α-helix	225-228	4
β-strand	235-240	6	74
β-strand	245	1	75
α-helix	251-254	4
α-helix	259-260	2
α-helix	272-275	4
α-helix	278-281	4
α-helix	282-291	10
β-strand	294-301	8	74
α-helix	305-314	10
β-strand	319-323	5	74
α-helix	330-341	12
β-strand	345	1	76
β-strand	347-349	3	72
α-helix	351-353	3
β-strand	356-363	8	73
β-strand	369-373	5	73
β-strand	378	1	76
β-strand	387-395	9	73
β-strand	402-408	7	72
β-strand	414-421	8	72
β-strand	442-444	3	77
β-strand	447-449	3	77
β-strand	454-455	2	78
β-strand	460-462	3	78
β-strand	481	1	68
α-helix	482	1
α-helix	483-486	4
β-strand	488-491	4	79
β-strand	494-497	4	79
β-strand	508	1	80
β-strand	514	1	80
β-strand	521-522	2	81
β-strand	525-526	2	81
β-strand	533-536	4	82
β-strand	539-542	4	82
α-helix	543	1
β-strand	546-547	2	83
β-strand	553-554	2	83
β-strand	561	1	84
β-strand	567	1	84
β-strand	574	1	85
β-strand	579	1	85
α-helix	597-598	2
α-helix	604-610	7
α-helix	621-624	4
β-strand	628-630	3	86
α-helix	631	1
β-strand	638-643	6	86
β-strand	649-656	8	86
β-strand	663-667	5	86
β-strand	672	1	86

Chain E: 16 helices, 81 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	87
β-strand	9-12	4	88
β-strand	21-25	5	89
β-strand	29-34	6	89
β-strand	40	1	90
β-strand	43	1	90
β-strand	45	1	91
β-strand	46-51	6	89
β-strand	56-59	4	89
β-strand	73	1	91
β-strand	76-81	6	92
β-strand	84-97	14	92
β-strand	100-110	11	92
α-helix	115-116	2
β-strand	117-119	3	92
α-helix	123-124	2
β-strand	339-340	2	93
β-strand	347-350	4	93
α-helix	353-356	4
β-strand	359-362	4	93
β-strand	370-372	3	93
α-helix	379-381	3
β-strand	389-394	6	94
β-strand	399-405	7	94
α-helix	408-410	3
β-strand	413-420	8	94
β-strand	423-431	9	94
β-strand	442-446	5	95
β-strand	456-460	5	95
β-strand	465-466	2	96
β-strand	469-471	3	96
β-strand	473-477	5	95
α-helix	483-485	3
β-strand	489-491	3	95
β-strand	497-502	6	96
β-strand	505-510	6	97
β-strand	519-524	6	97
α-helix	527-530	4
β-strand	532	1	98
β-strand	533-538	6	97
β-strand	539-540	2	99
β-strand	544-545	2	99
β-strand	551-554	4	97
α-helix	555-558	4
β-strand	565	1	98
β-strand	568-573	6	88
β-strand	582-587	6	88
β-strand	590-595	6	88
β-strand	596	1	87
β-strand	599-600	2	100
β-strand	602-609	8	18
β-strand	613	1	101
α-helix	628	1
β-strand	629-639	11	18
β-strand	654-662	9	102
β-strand	672-673	2	18
β-strand	678	1	18
β-strand	680-687	8	102
β-strand	692-700	9	18
β-strand	711-718	8	102
α-helix	726-728	3
β-strand	733-734	2	100
β-strand	742-746	5	102
α-helix	747	1
β-strand	748	1	101
α-helix	749-750	2
β-strand	762-767	6	103
β-strand	774-776	3	104
β-strand	779	1	104
β-strand	781-790	10	103
β-strand	795	1	105
β-strand	799-805	7	106
β-strand	808-811	4	103
β-strand	827-833	7	106
β-strand	839-846	8	106
β-strand	849	1	107
β-strand	851	1	105
β-strand	856-865	10	103
β-strand	874-882	9	106
β-strand	895-900	6	106
β-strand	901-905	5	104
β-strand	907-911	5	108
β-strand	929-940	12	108
β-strand	946-958	13	109
β-strand	961-962	2	109
β-strand	964-970	7	108
β-strand	980-984	5	109
α-helix	985-988	4
α-helix	991-994	4
β-strand	1000-1001	2	109
β-strand	1007-1018	12	109
β-strand	1023-1033	11	108
α-helix	1035-1040	6
β-strand	1046-1054	9	109
β-strand	1060-1062	3	104
α-helix	1068-1070	3
β-strand	1071-1077	7	109

Chain F: 28 helices, 46 β-strands

Element	Residues	Length	Sheet
α-helix	11-15	5
β-strand	22-24	3	110
α-helix	36-39	4
β-strand	40-41	2	110
α-helix	43-48	6
α-helix	53-55	3
β-strand	56-57	2	110
β-strand	62-65	4	111
β-strand	76-77	2	112
β-strand	80-85	6	111
β-strand	91-97	7	112
β-strand	105-112	8	113
α-helix	115-117	3
α-helix	118-124	7
α-helix	125-127	3
α-helix	128-138	11
β-strand	143-149	7	113
α-helix	162-166	5
β-strand	182-189	8	113
α-helix	192-200	9
β-strand	212	1	114
α-helix	214-222	9
α-helix	225-228	4
β-strand	234-241	8	113
β-strand	245	1	114
α-helix	251-254	4
α-helix	272-275	4
α-helix	278-281	4
α-helix	282-291	10
β-strand	294-300	7	113
α-helix	302-309	8
α-helix	311-314	4
β-strand	319-322	4	113
α-helix	330-343	14
β-strand	345	1	115
β-strand	347-349	3	111
β-strand	356-363	8	112
β-strand	369-373	5	112
β-strand	378	1	115
β-strand	387-395	9	112
α-helix	399-401	3
β-strand	402-408	7	111
β-strand	414-421	8	111
β-strand	441-444	4	116
β-strand	447-450	4	116
α-helix	451	1
β-strand	454-455	2	117
β-strand	461-462	2	117
α-helix	471-474	4
β-strand	481	1	107
α-helix	483-485	3
β-strand	488-491	4	118
β-strand	494-497	4	118
β-strand	507-508	2	119
β-strand	514-515	2	119
β-strand	521-522	2	120
β-strand	525-526	2	120
β-strand	533-536	4	121
β-strand	539-542	4	121
α-helix	543	1
β-strand	546-547	2	122
β-strand	553-554	2	122
β-strand	561	1	123
β-strand	567	1	123
β-strand	572-574	3	124
β-strand	579-581	3	124
α-helix	597-598	2
α-helix	601-603	3
α-helix	604-611	8
α-helix	615-617	3
β-strand	628-630	3	125
β-strand	640-643	4	125
β-strand	649-657	9	125
β-strand	662-672	11	125

Chain G: 19 helices, 83 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	126
β-strand	9-12	4	127
β-strand	21-25	5	128
β-strand	29-33	5	128
β-strand	38-40	3	129
β-strand	43-44	2	129
β-strand	45	1	130
β-strand	47-50	4	128
β-strand	57-59	3	128
α-helix	60-61	2
β-strand	69	1	131
β-strand	73	1	130
β-strand	76-80	5	131
β-strand	85-96	12	131
β-strand	101-110	10	131
α-helix	115-116	2
β-strand	117-119	3	131
α-helix	123-125	3
β-strand	338-340	3	132
β-strand	347-349	3	132
α-helix	353-356	4
β-strand	360-362	3	132
β-strand	370-372	3	132
α-helix	379-381	3
β-strand	389-395	7	133
β-strand	398-405	8	133
α-helix	408-410	3
β-strand	412	1	134
β-strand	413-420	8	133
β-strand	423-431	9	133
β-strand	439	1	134
β-strand	443-446	4	135
β-strand	456-460	5	135
β-strand	465	1	136
β-strand	469-471	3	137
β-strand	473-477	5	135
α-helix	478-479	2
β-strand	489-491	3	135
β-strand	497-502	6	137
β-strand	506-510	5	138
β-strand	519-523	5	138
α-helix	527-530	4
β-strand	532	1	139
β-strand	533-538	6	138
β-strand	539-540	2	140
β-strand	544-545	2	140
β-strand	552-554	3	138
α-helix	555-558	4
β-strand	565	1	139
β-strand	568-573	6	127
β-strand	582-587	6	127
β-strand	590-595	6	127
β-strand	596	1	126
α-helix	597-598	2
β-strand	599-600	2	141
β-strand	602-609	8	62
β-strand	613	1	142
α-helix	615-618	4
β-strand	629-639	11	62
α-helix	648-651	4
β-strand	655-662	8	143
β-strand	672-673	2	62
β-strand	680-681	2	143
β-strand	684-686	3	143
β-strand	692-700	9	62
α-helix	710	1
β-strand	711-719	9	143
α-helix	726-728	3
β-strand	733-734	2	141
β-strand	741-746	6	143
α-helix	747	1
β-strand	748	1	142
α-helix	749-751	3
β-strand	762-767	6	144
β-strand	774-776	3	145
β-strand	779	1	145
β-strand	781-790	10	144
β-strand	795	1	146
β-strand	799-805	7	106
β-strand	808-810	3	144
β-strand	827-833	7	106
β-strand	839-846	8	106
β-strand	851	1	146
β-strand	856-865	10	144
β-strand	874-882	9	106
β-strand	895-900	6	106
β-strand	901-905	5	145
β-strand	907-911	5	147
β-strand	929-940	12	147
β-strand	948-958	11	148
β-strand	961-962	2	148
β-strand	964-970	7	147
β-strand	979-984	6	148
α-helix	991-996	6
β-strand	1000-1001	2	148
β-strand	1007-1015	9	148
β-strand	1023-1033	11	147
α-helix	1035-1038	4
β-strand	1046-1054	9	148
β-strand	1060-1062	3	145
α-helix	1068-1070	3
β-strand	1071-1077	7	148

Chain H: 29 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	11-15	5
β-strand	22-24	3	149
α-helix	36-39	4
β-strand	40-41	2	149
α-helix	43-48	6
α-helix	53-55	3
β-strand	56-57	2	149
β-strand	62-65	4	150
β-strand	76-77	2	151
β-strand	80-85	6	150
β-strand	91-97	7	151
β-strand	106-112	7	152
α-helix	115-117	3
α-helix	118-124	7
α-helix	128-135	8
β-strand	143-149	7	152
α-helix	162-166	5
α-helix	177-179	3
β-strand	182-184	3	152
β-strand	189	1	152
α-helix	192-199	8
α-helix	203-204	2
β-strand	212	1	153
α-helix	214-223	10
β-strand	235-241	7	152
β-strand	245	1	153
α-helix	251-254	4
α-helix	259-260	2
β-strand	270	1	152
α-helix	272-275	4
α-helix	278-281	4
α-helix	282-291	10
β-strand	294-301	8	152
α-helix	305-312	8
β-strand	319-323	5	152
α-helix	330-341	12
β-strand	345	1	154
β-strand	347-349	3	150
α-helix	350-353	4
β-strand	356-363	8	151
β-strand	364	1	155
β-strand	368	1	155
β-strand	373	1	151
β-strand	378	1	154
β-strand	387-395	9	151
α-helix	398-400	3
β-strand	402-408	7	150
β-strand	414-421	8	150
β-strand	443-444	2	156
β-strand	447-448	2	156
α-helix	449-451	3
β-strand	454-455	2	157
β-strand	461-462	2	157
α-helix	470-474	5
α-helix	483-485	3
β-strand	488-491	4	158
β-strand	494-497	4	158
α-helix	498-499	2
β-strand	508	1	159
β-strand	514	1	159
β-strand	521-522	2	160
β-strand	525-526	2	160
β-strand	533-536	4	161
β-strand	539-542	4	161
α-helix	543	1
β-strand	546-547	2	162
β-strand	553-554	2	162
β-strand	561	1	163
β-strand	567	1	163
β-strand	572-574	3	164
β-strand	579-581	3	164
α-helix	597-598	2
α-helix	600-602	3
α-helix	604-612	9
β-strand	628-630	3	165
β-strand	638-643	6	165
β-strand	649-656	8	165
β-strand	663-667	5	165

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-X	A, C, E, G	protein	1137	Homo sapiens	P20702 (AlphaFold model)
Integrin beta-2	B, D, F, H	protein	727	Homo sapiens	P05107 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>5ES4_1 Integrin alpha-X (chains A, C, E, G)
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPI
GLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLP
VSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQT
HFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITD
GKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDF
DALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGA
FLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQV
SRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPR
GWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGV
LGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVL
WVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDL
ALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLV
GKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNL
ELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTW
STSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELP
VKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQ
EAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSV
QEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEK
YKVHGCGGLENLYFQGGENAQCEKELQALEKENAQLEWELQALEKELAQWSHPQFEK

Sequence of entity 2 (B, D, F, H), FASTA

>5ES4_2 Integrin beta-2 (chains B, D, F, H)
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT
SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDD
LRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPF
AFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFA
TDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAV
TSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTY
DSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVL
PQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNN
SIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKC
RCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPC
GKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGM
DRYLIYVDESRECVDGCGLENLYFQGGKNAQCKKKLQALKKKNAQLKWKLQALKKKLAQG
GHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	27
MG	Magnesium ion	Mg	1
CA	Calcium ion	Ca	16

Primary citation

Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops. Sen, M., Springer, T.A. Proc Natl Acad Sci U S A (2016) 113:2940-2945. DOI 10.1073/pnas.1601379113 · PubMed

Other PDB entries of the same protein (UniProt P20702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N3Y 1.65 Å, Crystal structure of the alpha-X beta2 integrin I domain
4NEH 2.75 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
4NEN 2.9 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
3K6S 3.5 Å, Structure of integrin alphaXbeta2 ectodomain
3K72 3.7 Å, Structure of integrin alphaX beta2
3K71 3.95 Å, Structure of integrin alphaX beta2 ectodomain
2LUV Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin
9ECM Structure of the human integrin alphaX transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 5ES4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.