2LUV: Integrin alpha-X

Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin. Determined by solution NMR. Released 4 Jul 2012.

Method

Solution NMR

Organism

Homo sapiens

Chains

1

Atoms

276

Mol. weight

3.96 kDa

Released

4 Jul 2012

Explore 2LUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LUV contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Molecules and chains

>2LUV_1 Integrin alpha-X (chains A)
KVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK

Primary citation

Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin. Chua, G.L., Tang, X., Patra, T.A. et al. To be published.

Related structures

Other PDB entries of the same protein (UniProt P20702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 1N3Y 1.65 Å, Crystal structure of the alpha-X beta2 integrin I domain
• 4NEH 2.75 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
• 4NEN 2.9 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
• 5ES4 3.3 Å, Re-refinement of integrin ALPHAXBETA2 ectodomain in the closed/bent conformation
• 3K6S 3.5 Å, Structure of integrin alphaXbeta2 ectodomain
• 3K72 3.7 Å, Structure of integrin alphaX beta2
• 3K71 3.95 Å, Structure of integrin alphaX beta2 ectodomain
• 9ECM Structure of the human integrin alphaX transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 2LUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.