NMR Structure of the J-Domain and Clathrin Substrate Binding Domain of Bovine Auxilin. Determined by solution NMR. Released 11 Nov 2003.
Explore 1N4C in 3D Show helices and sheets RCSB PDB PDBe
1N4C contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 53-55 | 3 | |
| α-helix | 73-81 | 9 | |
| α-helix | 89-98 | 10 | |
| α-helix | 102-108 | 7 | |
| α-helix | 109-112 | 4 | |
| α-helix | 125-128 | 4 | |
| α-helix | 131-144 | 14 | |
| α-helix | 147-150 | 4 | |
| α-helix | 156-172 | 17 | |
| α-helix | 173-177 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Auxilin | A | protein | 182 | Bos taurus | Q27974 (AlphaFold model) |
>1N4C_1 Auxilin (chains A) GPLGSPEFSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFEDLLSGQGF NAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKW KPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKP LY
Structure of the functional fragment of auxilin required for catalytic uncoating of clathrin-coated vesicles. Gruschus, J.M., Han, C.J., Greener, T. et al. Biochemistry (2004) 43:3111-3119. DOI 10.1021/bi0354740 · PubMed
Other PDB entries of the same protein (UniProt Q27974 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1N4C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.