1N6M: Claret segregational protein

Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor protein, Ncd. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Oct 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 5,886
Mol. weight: 93.85 kDa
Ligands: ADP, MG
Released: 28 Oct 2003

Explore 1N6M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N6M contains 26 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	293-346	54
β-strand	349-355	7	1
α-helix	356-359	4
β-strand	367	1	2
β-strand	369-372	4	3
β-strand	377-381	5	3
β-strand	395-397	3	3
β-strand	400-402	3	1
α-helix	408-423	16
β-strand	427-433	7	1
β-strand	434	1	4
α-helix	440-444	5
β-strand	446-447	2	5
β-strand	450-451	2	5
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-484	12	1
β-strand	489-491	3	1
β-strand	502-505	4	6
β-strand	508-514	7	6
β-strand	520-521	2	1
α-helix	525-538	14
β-strand	554-565	12	1
β-strand	570-580	11	1
α-helix	581-582	2
β-strand	583	1	4
α-helix	585-587	3
α-helix	597-614	18
α-helix	622-624	3
α-helix	626-630	5
α-helix	632-634	3
β-strand	640-647	8	1
β-strand	650	1	2
α-helix	651-653	3
α-helix	654-668	15

Chain B: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	294-296	3
α-helix	297-346	50
β-strand	349-355	7	7
α-helix	356-359	4
β-strand	367	1	8
β-strand	369-372	4	9
β-strand	377-381	5	9
α-helix	385-387	3
β-strand	394-397	4	9
β-strand	400-402	3	7
α-helix	408-422	15
β-strand	427	1	10
β-strand	429-434	6	7
α-helix	440-444	5
β-strand	446-447	2	11
β-strand	450-451	2	11
α-helix	453-468	16
β-strand	474-475	2	12
β-strand	477-479	3	13
β-strand	520-522	3	13
α-helix	525-538	14
β-strand	555-558	4	14
β-strand	559-560	2	13
β-strand	562-564	3	12
β-strand	572-573	2	12
β-strand	575	1	10
β-strand	577-580	4	14
α-helix	601-614	14
α-helix	626-630	5
β-strand	641-647	7	7
β-strand	650	1	8
α-helix	654-667	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Claret segregational protein	A, B	protein	409	Drosophila melanogaster	P20480 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1N6M_1 Claret segregational protein (chains A, B)
MHAALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRV
FCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDI
FEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNL
GWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHL
MHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTST
RMTETKNIKRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQ
DCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Primary citation

Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor protein, Ncd. Yun, M., Bronner, C.E., Park, C.-G. et al. EMBO J (2003) 22:1-8. DOI 10.1093/emboj/cdg531 · PubMed

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U06 2.35 Å, Crystal structure of the kinesin-14 NcdG347D
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
3L1C 2.75 Å, Kinesin-14 Protein Ncd, T436S Mutant
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
1CZ7 2.9 Å, The crystal structure of a minus-end directed microtubule motor protein ncd reveals…
5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
8YUE 3.15 Å, Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 1N6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.