1N7M: Germline 7G12 with N-methylmesoporphyrin

Germline 7G12 with N-methylmesoporphyrin. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Feb 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,809
Mol. weight: 46.98 kDa
Ligands: MMP
Released: 4 Feb 2003

Explore 1N7M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N7M contains 16 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	121-125	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
α-helix	155	1
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-188	6
β-strand	191-197	7	5
β-strand	205-210	6	5

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	9-12	4	2
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-40	7	2
β-strand	44-51	8	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	104	1	2
β-strand	108-112	5	2
β-strand	118	1	7
α-helix	119-120	2
β-strand	121-125	5	8
α-helix	126-128	3
β-strand	136-146	11	8
β-strand	147	1	7
β-strand	152-155	4	9
α-helix	156-158	3
β-strand	160	1	9
β-strand	164-166	3	8
α-helix	167-169	3
β-strand	170-171	2	8
β-strand	177-186	10	8
β-strand	196-201	6	9
α-helix	202-204	3
β-strand	206-211	6	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Germline Metal Chelatase Catalytic Antibody, chain H	H	protein	213	Mus musculus, Homo sapiens
Germline Metal Chelatase Catalytic Antibody, chain L	L	protein	216	Mus musculus, Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>1N7M_1 Germline Metal Chelatase Catalytic Antibody, chain H (chains H)
ELVMTQTPKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLLIYSASNRYTGVPD
RFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Sequence of entity 2 (L), FASTA

>1N7M_2 Germline Metal Chelatase Catalytic Antibody, chain L (chains L)
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCTRRDSDYWGAGTTVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS

Ligands and cofactors

ID	Name	Formula	Copies
MMP	N-methylmesoporphyrin	C35 H40 N4 O4	1

Primary citation

Structural evidence for substrate strain in antibody catalysis. Yin, J., Andryski, S.E., Beuscher IV, A.E. et al. Proc Natl Acad Sci U S A (2003) 100:856-861. DOI 10.1073/pnas.0235873100 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement

Browse structure collections

About this viewer

MolViewer shows 1N7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.