1NBQ: Human Junctional Adhesion Molecule Type 1

Crystal Structure of Human Junctional Adhesion Molecule Type 1. Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Apr 2003.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,299
Mol. weight: 45.41 kDa
Released: 1 Apr 2003

Explore 1NBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NBQ contains 6 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	37	1	2
β-strand	40-41	2	3
β-strand	47-49	3	4
β-strand	51-53	3	1
β-strand	58-66	9	2
β-strand	69-72	4	2
β-strand	74-75	2	5
β-strand	78-79	2	5
β-strand	88-90	3	4
β-strand	93-95	3	4
β-strand	106-113	8	2
β-strand	119-120	2	2
β-strand	123-125	3	2
β-strand	128-129	2	3
β-strand	130	1	6
α-helix	131-136	6
β-strand	140	1	7
β-strand	142-144	3	8
β-strand	149-151	3	9
β-strand	159	1	6
β-strand	163-168	6	10
β-strand	197-199	3	9
α-helix	204-206	3
β-strand	210-215	6	10
α-helix	221	1
β-strand	222-223	2	10
β-strand	227	1	10
β-strand	230-232	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Junctional adhesion molecule 1	A, B	protein	209	Homo sapiens	Q9Y624 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1NBQ_1 Junctional adhesion molecule 1 (chains A, B)
AMGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYE
DRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSAT
IGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSA
SDTGEYSCEARNGYGTPMTSNAVRMEAVE

Primary citation

Crystal structure of human junctional adhesion molecule 1: Implications for reovirus binding. Prota, A.E., Campbell, J.A., Schelling, P. et al. Proc Natl Acad Sci U S A (2003) 100:5366-5371. DOI 10.1073/pnas.0937718100 · PubMed

Other PDB entries of the same protein (UniProt Q9Y624 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
4ODB 3.2 Å, Crystal structure of the T1L reovirus attachment protein sigma1 in complex with…
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 1NBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.