3TSZ: PDZ3-SH3-GUK core module from human ZO-1

crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer peptide from human JAM-A cytoplasmic tail. Determined by X-ray diffraction at 2.5 Å resolution. Released 12 Oct 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,849
Mol. weight: 46.03 kDa
Released: 12 Oct 2011

Explore 3TSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TSZ contains 17 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	422-428	7	1
β-strand	430	1	2
β-strand	432	1	2
β-strand	435-440	6	1
β-strand	444-450	7	1
α-helix	455-458	4
β-strand	465-470	6	1
β-strand	473-474	2	1
α-helix	480-489	10
α-helix	491	1
β-strand	495-502	8	1
α-helix	504-507	4
α-helix	508-510	3
β-strand	519-523	5	3
β-strand	527	1	4
β-strand	534	1	3
β-strand	537	1	4
β-strand	542-547	6	3
α-helix	550-552	3
β-strand	556-562	7	3
α-helix	564-566	3
β-strand	568-575	8	3
α-helix	577-584	8
β-strand	633-640	8	3
β-strand	647-650	4	5
α-helix	654-664	11
β-strand	669-671	3	5
α-helix	672-678	7
α-helix	691-698	8
β-strand	703-706	4	5
α-helix	710-718	9
β-strand	724-729	6	5
α-helix	733-743	11
α-helix	751-765	15
α-helix	766-768	3
β-strand	771-774	4	5
α-helix	781-795	15
β-strand	797-801	5	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	423-426	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A	protein	391	Homo sapiens	Q07157 (AlphaFold model)
Junctional adhesion molecule A	B	protein	12	Homo sapiens	Q9Y624 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TSZ_1 Tight junction protein ZO-1 (chains A)
GSHMILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNN
VDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESP
YGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPK
TAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGP
IADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNA
VDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTT
INLNSMNDGWYGALKEAIQQQQNQLVWVSEG

Sequence of entity 2 (B), FASTA

>3TSZ_2 Junctional adhesion molecule A (chains B)
EGEFKQTSSFLV

Primary citation

The Src Homology 3 Domain Is Required for Junctional Adhesion Molecule Binding to the Third PDZ Domain of the Scaffolding Protein ZO-1. Nomme, J., Fanning, A.S., Caffrey, M. et al. J Biol Chem (2011) 286:43352-43360. DOI 10.1074/jbc.M111.304089 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1
3SHU 2.75 Å, Crystal structure of ZO-1 PDZ3

Browse structure collections

About this viewer

MolViewer shows 3TSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.