3EOY: Reovirus sigma1

Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A. Determined by X-ray diffraction at 3.4 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: reovirus, Homo sapiens
Chains: 12
Atoms: 12,227
Mol. weight: 176.64 kDa
Released: 4 Nov 2008

Explore 3EOY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EOY contains 42 α-helices and 162 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	1
β-strand	300-303	4	2
β-strand	306-309	4	2
α-helix	311-314	4
β-strand	316-328	13	3
β-strand	331-344	14	3
β-strand	347-352	6	3
α-helix	353-354	2
β-strand	355-358	4	3
β-strand	363-369	7	3
β-strand	374	1	3
α-helix	380-383	4
β-strand	385	1	4
β-strand	394-404	11	3
β-strand	410-422	13	3
β-strand	425-431	7	3
β-strand	440-443	4	3
α-helix	444-445	2
β-strand	446-451	6	3
β-strand	452	1	4

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	5
β-strand	300-303	4	1
β-strand	306-309	4	1
α-helix	311-314	4
β-strand	316-328	13	6
β-strand	331-344	14	6
β-strand	347-352	6	6
α-helix	353-354	2
β-strand	355-358	4	6
β-strand	363-369	7	6
β-strand	374	1	6
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	7
β-strand	394-404	11	6
β-strand	410-422	13	6
β-strand	425-431	7	6
β-strand	440-443	4	6
β-strand	446-451	6	6
β-strand	452	1	7
α-helix	453	1

Chain C: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	2
β-strand	300-302	3	5
β-strand	307-309	3	5
α-helix	311-314	4
β-strand	316-328	13	8
β-strand	331-344	14	8
β-strand	347-352	6	8
α-helix	353-354	2
β-strand	355-358	4	8
β-strand	363-369	7	8
β-strand	374	1	8
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	9
β-strand	394-404	11	8
β-strand	410-422	13	8
β-strand	425-431	7	8
β-strand	440-443	4	8
β-strand	446-451	6	8
β-strand	452	1	9
α-helix	453	1

Chain D: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	10
β-strand	300-303	4	11
β-strand	306-309	4	11
α-helix	311-314	4
β-strand	316-328	13	12
β-strand	331-344	14	12
β-strand	347-352	6	12
β-strand	355-358	4	12
β-strand	363-369	7	12
β-strand	374	1	12
α-helix	380-383	4
β-strand	385	1	13
β-strand	394-404	11	12
β-strand	410-422	13	12
β-strand	425-431	7	12
β-strand	440-443	4	12
α-helix	444-445	2
β-strand	446-451	6	12
β-strand	452	1	13
α-helix	453	1

Chains E and F: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	14
β-strand	300-303	4	10
β-strand	306-309	4	10
α-helix	311-314	4
β-strand	316-328	13	15
β-strand	331-344	14	15
β-strand	347-352	6	15
α-helix	353-354	2
β-strand	355-358	4	15
β-strand	363-369	7	15
β-strand	374	1	15
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	16
β-strand	394-404	11	15
β-strand	410-422	13	15
β-strand	425-431	7	15
β-strand	440-443	4	15
α-helix	444-445	2
β-strand	446-451	6	15
β-strand	452	1	16
α-helix	453	1

Chains G and I: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	19
β-strand	37-40	4	20
β-strand	46-49	4	21
β-strand	51-53	3	19
β-strand	59-66	8	20
β-strand	69-74	6	20
β-strand	79	1	20
α-helix	81-84	4
β-strand	87-88	2	21
β-strand	93-96	4	21
α-helix	101-103	3
β-strand	105-112	8	20
β-strand	119-128	10	20

Chain H: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	22
β-strand	37-40	4	23
β-strand	46-49	4	24
β-strand	51-53	3	22
β-strand	59-65	7	23
β-strand	70-74	5	23
β-strand	79	1	23
α-helix	81-84	4
β-strand	87-88	2	24
β-strand	93-96	4	24
α-helix	101-103	3
β-strand	105-112	8	23
β-strand	119-128	10	23

Chain J: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	28
β-strand	37-40	4	29
β-strand	46-49	4	30
β-strand	51-53	3	28
β-strand	59-64	6	29
β-strand	71-74	4	29
β-strand	79	1	29
α-helix	81-84	4
β-strand	87-88	2	30
β-strand	93-96	4	30
α-helix	101-103	3
β-strand	105-112	8	29
β-strand	119-128	10	29

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C, D, E, F	protein	165	reovirus	P03528
Junctional adhesion molecule A	G, H, I, J, K, L	protein	104	Homo sapiens	Q9Y624 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>3EOY_1 Outer capsid protein sigma-1 (chains A, B, C, D, E, F)
GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHI
CLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQ
YMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>3EOY_2 Junctional adhesion molecule A (chains G, H, I, J, K, L)
GSSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYED
RVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL

Primary citation

Structure of reovirus sigma1 in complex with its receptor junctional adhesion molecule-A. Kirchner, E., Guglielmi, K.M., Strauss, H.M. et al. PLoS Pathog (2008) 4:e1000235-e1000235. DOI 10.1371/journal.ppat.1000235 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
2OJ6 1.85 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose

Browse structure collections

About this viewer

MolViewer shows 3EOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.