Bovine prothrombin fragment 1 in complex with calcium ion. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Sept 2003.
Explore 1NL1 in 3D Show helices and sheets RCSB PDB PDBe
1NL1 contains 10 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-9 | 3 | |
| α-helix | 11-12 | 2 | |
| α-helix | 14 | 1 | |
| α-helix | 15-19 | 5 | |
| α-helix | 25-31 | 7 | |
| α-helix | 35-47 | 13 | |
| α-helix | 55-63 | 9 | |
| β-strand | 67 | 1 | 1 |
| β-strand | 80 | 1 | 2 |
| β-strand | 81 | 1 | 3 |
| α-helix | 85 | 1 | |
| β-strand | 86 | 1 | 2 |
| β-strand | 87 | 1 | 4 |
| α-helix | 88-89 | 2 | |
| β-strand | 116 | 1 | 5 |
| β-strand | 126-128 | 3 | 5 |
| β-strand | 129 | 1 | 4 |
| β-strand | 136-138 | 3 | 5 |
| β-strand | 139 | 1 | 3 |
| α-helix | 142 | 1 | |
| β-strand | 143 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prothrombin | A | protein | 147 | Bos taurus | P00735 (AlphaFold model) |
>1NL1_1 Prothrombin (chains A) ANKGFLEEVRKGNLERECLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNE CLEGNCAEGVGMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDG SITGPWCYTTSPTLRREECSVPVCGQD
Structural basis of membrane binding by Gla domains of vitamin K-dependent proteins. Huang, M., Rigby, A.C., Morelli, X. et al. Nat Struct Biol (2003) 10:751-756. DOI 10.1038/nsb971 · PubMed
Other PDB entries of the same protein (UniProt P00735 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1NL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.