The Crystal Structure of Bovine Thrombin in complex with Hirudin (C6U/C14U) at 1.9 Angstroms Resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Mar 2021.
Explore 7A0E in 3D Show helices and sheets RCSB PDB PDBe
7A0E contains 20 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 5-6 | 2 | 2 |
| α-helix | 7-8 | 2 | |
| β-strand | 15-20 | 6 | 3 |
| β-strand | 25-32 | 8 | 3 |
| β-strand | 37-40 | 4 | 3 |
| α-helix | 42-44 | 3 | |
| β-strand | 46-47 | 2 | 4 |
| α-helix | 48-50 | 3 | |
| β-strand | 52-53 | 2 | 4 |
| α-helix | 56-58 | 3 | |
| β-strand | 59-63 | 5 | 3 |
| β-strand | 77-79 | 3 | 3 |
| β-strand | 81-86 | 6 | 3 |
| β-strand | 91 | 1 | 5 |
| β-strand | 97 | 1 | 5 |
| β-strand | 101-105 | 5 | 3 |
| α-helix | 117-118 | 2 | |
| β-strand | 119 | 1 | 2 |
| α-helix | 120-121 | 2 | |
| α-helix | 123-129 | 7 | |
| β-strand | 135-140 | 6 | 2 |
| α-helix | 152-155 | 4 | |
| β-strand | 161-167 | 7 | 2 |
| α-helix | 170-175 | 6 | |
| α-helix | 180-181 | 2 | |
| β-strand | 185-188 | 4 | 2 |
| α-helix | 190-191 | 2 | |
| β-strand | 199 | 1 | 1 |
| β-strand | 208-212 | 5 | 2 |
| β-strand | 219-227 | 9 | 2 |
| β-strand | 228-229 | 2 | 6 |
| β-strand | 238-242 | 5 | 2 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-255 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 6 |
| β-strand | 5 | 1 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 14-15 | 2 | 7 |
| β-strand | 21-22 | 2 | 7 |
| β-strand | 26-29 | 4 | 9 |
| α-helix | 35-37 | 3 | |
| β-strand | 38-41 | 4 | 9 |
| β-strand | 45-46 | 2 | 8 |
| α-helix | 47-50 | 4 | |
| β-strand | 53 | 1 | 3 |
| α-helix | 56-60 | 5 | |
| α-helix | 61-63 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -1-2 | 4 | |
| α-helix | 16-18 | 3 | |
| α-helix | 25-33 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prothrombin | HHH | protein | 259 | Bos taurus | P00735 (AlphaFold model) |
| Hirudin variant-1 | III | protein | 65 | Hirudo medicinalis | P01050 (AlphaFold model) |
| Prothrombin | LLL | protein | 49 | Bos taurus | P00735 (AlphaFold model) |
>7A0E_1 Prothrombin (chains HHH) IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLL VRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCL PDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIR ITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY THVFRLKKWIQKVIDRLGS
>7A0E_2 Hirudin variant-1 (chains III) VVYTDUTESGQNLULCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIP EEYLQ
>7A0E_3 Prothrombin (chains LLL) TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (NA) are not listed.
Diselenide crosslinks for enhanced and simplified oxidative protein folding. Mousa, R., Hidmi, T., Pomyalov, S. et al. Commun Chem (2021) 4:30. DOI 10.1038/s42004-021-00463-9
Other PDB entries of the same protein (UniProt P00735 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7A0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.