1NNT: Ovotransferrin

Structural evidence for a PH-sensitive di-lysine trigger in the hen ovotransferrin N-lobe: implications for transferrin iron release. Determined by X-ray diffraction at 2.3 Å resolution. Released 15 Oct 1994.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Gallus gallus
Chains: 1
Atoms: 2,646
Mol. weight: 36.22 kDa
Ligands: CO3, FE
Released: 15 Oct 1994

Explore 1NNT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NNT contains 16 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	9-11	3	2
α-helix	14-25	12
β-strand	33	1	1
β-strand	36-38	3	2
α-helix	42-51	10
β-strand	56	1	2
β-strand	57-59	3	3
α-helix	61-68	8
β-strand	75-84	10	3
β-strand	87-89	3	3
β-strand	91-99	9	4
α-helix	107-109	3
β-strand	113-116	4	4
α-helix	122-126	5
α-helix	127-134	8
β-strand	142	1	5
β-strand	145	1	5
α-helix	148-155	8
β-strand	158-160	3	4
α-helix	190-199	10
β-strand	205-209	5	4
α-helix	212-216	5
α-helix	221-223	3
β-strand	224-227	4	4
β-strand	233-235	3	4
β-strand	245-248	4	4
α-helix	249-250	2
β-strand	251-254	4	3
α-helix	260-274	15
α-helix	293-295	3
β-strand	304-309	6	3
α-helix	310-311	2
α-helix	316-320	5
α-helix	322-329	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ovotransferrin	A	protein	328	Gallus gallus	P02789 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NNT_1 OVOTRANSFERRIN (chains A)
SVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLDGGQA
FEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLGRSAG
WNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCAR
NAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYKTCNW
ARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSA
IMLKRVPSLMDSQLYLGFEYYSAIQSMR

Ligands and cofactors

ID	Name	Formula	Copies
CO3	Carbonate ion	C O3	1
FE	FE (III) ion	Fe	1

Primary citation

Structural evidence for a pH-sensitive dilysine trigger in the hen ovotransferrin N-lobe: implications for transferrin iron release. Dewan, J.C., Mikami, B., Hirose, M. et al. Biochemistry (1993) 32:11963-11968. DOI 10.1021/bi00096a004 · PubMed

Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8X3H 0.93 Å, Crystal structure of iron-bound recombinant ovotransferrin N-lobe at 0.93 angstrom…
1IEJ 1.65 Å, Ovotransferrin, N-terminal lobe, holo form, at 1.65 a resolution
1TFA 1.9 Å, Ovotransferrin, N-terminal lobe, apo form
1NFT 2.1 Å, Ovotransferrin, N-terminal lobe, iron loaded open form
2D3I 2.15 Å, Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution
1IQ7 2.3 Å, Ovotransferrin, C-Terminal Lobe, Apo Form
1OVT 2.4 Å, Refined crystallographic structure of hen ovotransferrin at 2.4 Å resolution
1N04 2.8 Å, Diferric chicken serum transferrin at 2.8 A resolution.
1AIV 3.0 Å, Apo ovotransferrin
8FEI 3.0 Å, CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6)
1D9K 3.2 Å, Crystal structure of complex between D10 TCR and pmhc I-ak/ca
1RYX 3.5 Å, Crystal structure of hen serum transferrin in apo- form

Browse structure collections

About this viewer

MolViewer shows 1NNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.