CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6). Determined by electron microscopy at 3.0 Å resolution. Released 8 Feb 2023.
Explore 8FEI in 3D Show helices and sheets RCSB PDB PDBe
8FEI contains 33 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| α-helix | 14-27 | 14 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 42-50 | 9 | |
| β-strand | 56 | 1 | 1 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-67 | 7 | |
| β-strand | 75-81 | 7 | 2 |
| β-strand | 91-99 | 9 | 3 |
| α-helix | 107-109 | 3 | |
| β-strand | 113-115 | 3 | 3 |
| α-helix | 122-126 | 5 | |
| α-helix | 127-134 | 8 | |
| α-helix | 148-155 | 8 | |
| β-strand | 158-160 | 3 | 3 |
| β-strand | 171 | 1 | 3 |
| α-helix | 178-181 | 4 | |
| α-helix | 190-199 | 10 | |
| β-strand | 205-209 | 5 | 3 |
| α-helix | 212-216 | 5 | |
| α-helix | 221-223 | 3 | |
| β-strand | 224-227 | 4 | 3 |
| β-strand | 233-234 | 2 | 3 |
| α-helix | 239-242 | 4 | |
| β-strand | 245-248 | 4 | 3 |
| α-helix | 249-250 | 2 | |
| β-strand | 251-254 | 4 | 2 |
| α-helix | 259-274 | 16 | |
| β-strand | 306-309 | 4 | 2 |
| α-helix | 310-311 | 2 | |
| α-helix | 316-320 | 5 | |
| α-helix | 322-332 | 11 | |
| β-strand | 345-350 | 6 | 4 |
| α-helix | 351-364 | 14 | |
| β-strand | 369-374 | 6 | 4 |
| α-helix | 378-385 | 8 | |
| β-strand | 391 | 1 | 4 |
| β-strand | 392-394 | 3 | 5 |
| α-helix | 396-404 | 9 | |
| β-strand | 408-414 | 7 | 5 |
| α-helix | 427-429 | 3 | |
| β-strand | 430-438 | 9 | 6 |
| α-helix | 448-450 | 3 | |
| β-strand | 453-454 | 2 | 6 |
| α-helix | 461-465 | 5 | |
| α-helix | 466-474 | 9 | |
| β-strand | 487-488 | 2 | 6 |
| α-helix | 524-534 | 11 | |
| β-strand | 537-541 | 5 | 6 |
| α-helix | 544-548 | 5 | |
| α-helix | 556-558 | 3 | |
| α-helix | 563-565 | 3 | |
| β-strand | 566-570 | 5 | 6 |
| β-strand | 573-576 | 4 | 6 |
| β-strand | 587-590 | 4 | 6 |
| β-strand | 593-596 | 4 | 5 |
| α-helix | 598-600 | 3 | |
| α-helix | 601-615 | 15 | |
| β-strand | 643-646 | 4 | 5 |
| α-helix | 647-648 | 2 | |
| α-helix | 653-667 | 15 | |
| α-helix | 675-683 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ovotransferrin | A | protein | 705 | Gallus gallus | P02789 (AlphaFold model) |
>8FEI_1 Ovotransferrin (chains A) MKLILCTVLSLGIAAVCFAAPPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKAT YLDCIKAIANNEADAISLDGGQAFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKG TEFTVNDLQGKTSCHTGLGRSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCV PGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQK DEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSD FHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQLTPSPR ENRIQWCAVGKDEKSKCDRWSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYT AGVCGLVPVMAERYDDESQCSKTDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRT AGWVIPMGLIHNRTGTCNFDEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKY FGYTGALRCLVEKGDVAFIQHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDY RECNLAEVPTHAVVVRPEKANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLT KCLFKVREGTTYKEFLGDKFYTVISSLKTCNPSDILQMCSFLEGK
| ID | Name | Formula | Copies |
|---|---|---|---|
| FE | FE (III) ion | Fe | 2 |
CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6). Newton, T.P., Zimanyi, C., Kopylov, M. To be published.
Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.