Refined crystallographic structure of hen ovotransferrin at 2.4 Å resolution. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Sept 1995.
Explore 1OVT in 3D Show helices and sheets RCSB PDB PDBe
1OVT contains 36 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| α-helix | 14-27 | 14 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 42-50 | 9 | |
| β-strand | 56 | 1 | 1 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-67 | 7 | |
| α-helix | 74 | 1 | |
| β-strand | 75-81 | 7 | 2 |
| β-strand | 91-99 | 9 | 3 |
| α-helix | 106-108 | 3 | |
| β-strand | 113-115 | 3 | 3 |
| α-helix | 122-126 | 5 | |
| α-helix | 127-135 | 9 | |
| α-helix | 143-145 | 3 | |
| α-helix | 148-153 | 6 | |
| β-strand | 158-160 | 3 | 3 |
| α-helix | 168-171 | 4 | |
| α-helix | 180-182 | 3 | |
| α-helix | 190-199 | 10 | |
| β-strand | 205-209 | 5 | 3 |
| α-helix | 212-216 | 5 | |
| α-helix | 218-223 | 6 | |
| β-strand | 224-227 | 4 | 3 |
| β-strand | 233-235 | 3 | 3 |
| α-helix | 236-240 | 5 | |
| β-strand | 245-248 | 4 | 3 |
| α-helix | 249-250 | 2 | |
| β-strand | 251-254 | 4 | 2 |
| α-helix | 260-274 | 15 | |
| α-helix | 293-295 | 3 | |
| β-strand | 306-309 | 4 | 2 |
| α-helix | 310-311 | 2 | |
| α-helix | 316-319 | 4 | |
| α-helix | 322-330 | 9 | |
| β-strand | 345-350 | 6 | 4 |
| α-helix | 352-364 | 13 | |
| β-strand | 369-374 | 6 | 4 |
| α-helix | 377-385 | 9 | |
| β-strand | 391 | 1 | 4 |
| β-strand | 393-394 | 2 | 5 |
| α-helix | 396-404 | 9 | |
| β-strand | 408-414 | 7 | 5 |
| α-helix | 418-420 | 3 | |
| β-strand | 430-438 | 9 | 6 |
| α-helix | 446-448 | 3 | |
| β-strand | 452-455 | 4 | 6 |
| α-helix | 461-465 | 5 | |
| α-helix | 466-475 | 10 | |
| β-strand | 486-488 | 3 | 6 |
| α-helix | 497-499 | 3 | |
| α-helix | 524-533 | 10 | |
| β-strand | 537-541 | 5 | 6 |
| α-helix | 544-547 | 4 | |
| β-strand | 566-569 | 4 | 6 |
| β-strand | 575-576 | 2 | 6 |
| β-strand | 587-590 | 4 | 6 |
| α-helix | 591-592 | 2 | |
| β-strand | 593-596 | 4 | 5 |
| α-helix | 601-615 | 15 | |
| β-strand | 643-646 | 4 | 5 |
| α-helix | 653-657 | 5 | |
| α-helix | 659-668 | 10 | |
| α-helix | 675-684 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ovotransferrin | A | protein | 686 | Gallus gallus | P02789 (AlphaFold model) |
>1OVT_1 OVOTRANSFERRIN (chains A) APPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLD GGQAFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLG RSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKT KCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYK TCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLF KDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQLTPSPRENRIQWCAVGKDEKSKCDR WSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESQ CSKTDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNF DEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFI QHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEK ANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDK FYTVISSLKTCNPSDILQMCSFLEGK
Crystal structure of diferric hen ovotransferrin at 2.4 A resolution. Kurokawa, H., Mikami, B., Hirose, M. J Mol Biol (1995) 254:196-207. DOI 10.1006/jmbi.1995.0611 · PubMed
Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OVT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.