1NPE: Nidogen/Laminin Complex

Crystal structure of Nidogen/Laminin Complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 Aug 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,409
Mol. weight: 48.04 kDa
Ligands: CD
Released: 12 Aug 2003

Explore 1NPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NPE contains 8 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	914-929	16	1
β-strand	934	1	1
α-helix	936-938	3
β-strand	940-949	10	1
β-strand	950-956	7	2
β-strand	961-966	6	2
β-strand	971-976	6	2
β-strand	983-986	4	2
β-strand	993-999	7	3
β-strand	1004-1009	6	3
β-strand	1014-1019	6	3
β-strand	1026-1029	4	3
β-strand	1036-1042	7	4
β-strand	1047-1052	6	4
β-strand	1059-1064	6	4
β-strand	1071-1074	4	4
β-strand	1081-1087	7	5
β-strand	1092-1097	6	5
β-strand	1102-1107	6	5
β-strand	1110-1118	9	5
β-strand	1123-1129	7	6
β-strand	1132-1137	6	6
β-strand	1142-1147	6	6
β-strand	1152-1157	6	6
α-helix	1163-1165	3
β-strand	1168-1171	4	1

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	746-749	4	7
β-strand	754-757	4	7
β-strand	764-765	2	8
β-strand	771-772	2	8
α-helix	773	1
β-strand	776-779	4	9
β-strand	788-792	5	9
β-strand	799	1	10
β-strand	807	1	11
β-strand	814	1	11
β-strand	817	1	10
β-strand	821-822	2	12
β-strand	828-829	2	12
α-helix	830	1
β-strand	833-834	2	13
β-strand	847-848	2	13
β-strand	856	1	14
α-helix	857-859	3
β-strand	872	1	14
α-helix	873	1
β-strand	876-877	2	15
β-strand	883-884	2	15
α-helix	885	1
β-strand	889	1	16
α-helix	891-893	3
β-strand	898	1	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
nidogen	A	protein	267	Mus musculus	P10493 (AlphaFold model)
Laminin gamma-1 chain	B	protein	164	Mus musculus	P02468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NPE_1 nidogen (chains A)
GTHLLFAQTGKIERLPLERNTMKKTEAKAFLHIPAKVIIGLAFDCVDKVVYWTDISEPSI
GRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFWTDSQLDRIEVAKMDGTQRRVLFDTG
LVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDGTNRRILAQDNLGLPNGLTFDAFSSQ
LCWVDAGTHRAECLNPAQPGRRKVLEGLQYPFAVTSYGKNLYYTDWKTNSVIAMDLAISK
EMDTFHPHKQTRLYGITIALSQCPQGH

Sequence of entity 2 (B), FASTA

>1NPE_2 Laminin gamma-1 chain (chains B)
QPCPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQC
NDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYG
TVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCER

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	6

Primary citation

Complex between nidogen and laminin fragments reveals a paradigmatic beta-propeller interface. Takagi, J., Yang, Y.T., Liu, J.-H. et al. Nature (2003) 424:969-974. DOI 10.1038/nature01873 · PubMed

Other PDB entries of the same protein (UniProt P10493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GL4 2.0 Å, Nidogen-1 G2/Perlecan IG3 Complex
1H4U 2.2 Å, Domain G2 of mouse nidogen-1

Browse structure collections

About this viewer

MolViewer shows 1NPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.