1NSF: N-ethylmaleimide sensitive factor

D2 hexamerization domain of N-ethylmaleimide sensitive factor (NSF). Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Nov 1998.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Cricetulus griseus
Chains: 1
Atoms: 2,096
Mol. weight: 31.02 kDa
Ligands: MG, ATP
Released: 25 Nov 1998

Explore 1NSF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NSF contains 15 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	495	1	1
α-helix	512-530	19
β-strand	536-542	7	1
α-helix	549-560	12
β-strand	564-568	5	1
α-helix	570-572	3
α-helix	578-593	16
β-strand	597-602	6	1
α-helix	605-608	4
β-strand	612	1	2
β-strand	617	1	2
α-helix	620-629	10
α-helix	633-634	2
β-strand	639-646	8	1
α-helix	649-654	6
α-helix	657-659	3
β-strand	663-666	4	1
α-helix	668-669	2
β-strand	670-672	3	3
α-helix	673-683	11
α-helix	688-698	11
β-strand	702-705	4	3
α-helix	707-717	11
α-helix	722-724	3
α-helix	725-734	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-ethylmaleimide sensitive factor	A	protein	273	Cricetulus griseus	P18708 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NSF_1 N-ETHYLMALEIMIDE SENSITIVE FACTOR (chains A)
GAHMGDFLASLEQDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDR
TPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAY
KSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQ
EMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLML
IEMSLQMDPEYRVRKFLALLREEGASPLDFDLE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Structure of the ATP-dependent oligomerization domain of N-ethylmaleimide sensitive factor complexed with ATP. Yu, R.C., Hanson, P.I., Jahn, R. et al. Nat Struct Biol (1998) 5:803-811. DOI 10.1038/1843 · PubMed

Other PDB entries of the same protein (UniProt P18708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D2N 1.75 Å, D2 domain of N-ethylmaleimide-sensitive fusion protein
1QCS 1.9 Å, N-terminal domain of N-ethylmaleimide sensitive factor (NSF)
1QDN 2.3 Å, Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
9PFC 3.15 Å, NSF, substrate free, hydrolyzing, class 26
9OK5 3.29 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 16
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5
9PB9 3.45 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 8
9PBA 3.47 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 9
9OLJ 3.52 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18

Browse structure collections

About this viewer

MolViewer shows 1NSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.