9PFC: NSF, substrate free, hydrolyzing, class 26

NSF, substrate free, hydrolyzing, class 26. Determined by electron microscopy at 3.15 Å resolution. Released 8 Oct 2025.

Method: Electron microscopy
Resolution: 3.15 Å
Organism: Cricetulus griseus
Chains: 6
Atoms: 29,491
Mol. weight: 503.54 kDa
Ligands: PO4, MG, ADP, ATP
Released: 8 Oct 2025

Explore 9PFC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PFC contains 189 α-helices and 143 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	14-19	6
β-strand	22-24	3	1
β-strand	34-40	7	1
β-strand	43-51	9	1
α-helix	56	1
β-strand	59-62	4	1
α-helix	64-70	7
β-strand	77-83	7	1
α-helix	87-90	4
β-strand	91	1	2
β-strand	92-101	10	3
α-helix	104-106	3
β-strand	111-113	3	4
α-helix	114-125	12
β-strand	128-131	4	2
β-strand	135-140	6	3
β-strand	143-154	12	3
α-helix	155-158	4
β-strand	171	1	3
β-strand	174-177	4	2
β-strand	182-187	6	3
α-helix	188	1
β-strand	194-196	3	4
α-helix	215-218	4
α-helix	225-234	10
β-strand	256-259	4	5
α-helix	266-276	11
α-helix	282	1
β-strand	283	1	5
α-helix	284	1
α-helix	287-290	4
α-helix	298-315	18
α-helix	320-322	3
β-strand	323-327	5	5
α-helix	330-333	4
α-helix	348-358	11
β-strand	367-373	7	5
α-helix	376-378	3
β-strand	385	1	6
β-strand	388	1	6
β-strand	392-394	3	5
α-helix	400-410	11
α-helix	413-417	5
β-strand	420	1	7
α-helix	426-432	7
α-helix	438-461	24
α-helix	467-472	6
β-strand	476	1	7
α-helix	479-486	8
β-strand	495	1	8
α-helix	512-525	14
β-strand	536-542	7	9
α-helix	550-560	11
β-strand	564	1	8
β-strand	566-568	3	9
α-helix	570-572	3
α-helix	578-592	15
β-strand	600-603	4	9
α-helix	605-608	4
β-strand	612	1	10
β-strand	617	1	10
α-helix	620-629	10
β-strand	640-646	7	9
α-helix	650-654	5
β-strand	664-666	3	9
β-strand	670	1	11
α-helix	673-683	11
α-helix	688-697	10
β-strand	705	1	11
α-helix	707-717	11
α-helix	726-735	10

Chain B: 36 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	12
α-helix	14-19	6
β-strand	22-24	3	12
β-strand	34-40	7	12
β-strand	43-51	9	12
α-helix	56	1
β-strand	59-62	4	12
α-helix	64-70	7
β-strand	77-83	7	12
α-helix	87-90	4
β-strand	91	1	13
β-strand	92-101	10	14
α-helix	104-106	3
β-strand	111-113	3	15
α-helix	114-125	12
β-strand	129-131	3	13
β-strand	135-140	6	14
β-strand	143-154	12	14
α-helix	155-158	4
β-strand	171	1	14
β-strand	174-176	3	13
β-strand	182-187	6	14
α-helix	188	1
β-strand	194-196	3	15
α-helix	215-218	4
α-helix	225-230	6
α-helix	231-235	5
α-helix	242-248	7
β-strand	255-259	5	16
α-helix	266-276	11
α-helix	280-282	3
α-helix	287-290	4
α-helix	299-306	8
α-helix	307-309	3
α-helix	310-316	7
β-strand	323-327	5	16
α-helix	348-358	11
β-strand	367-373	7	16
β-strand	386	1	17
β-strand	388	1	17
β-strand	392-394	3	16
α-helix	400-410	11
α-helix	413-416	4
β-strand	420	1	18
α-helix	426-432	7
α-helix	444-454	11
β-strand	458-459	2	19
β-strand	463-464	2	19
β-strand	475	1	18
α-helix	477-481	5
α-helix	496-502	7
α-helix	512-527	16
β-strand	536-542	7	20
α-helix	551-558	8
β-strand	566-568	3	20
α-helix	570-572	3
α-helix	578-592	15
β-strand	600-603	4	20
α-helix	605-608	4
β-strand	612	1	21
β-strand	617	1	21
α-helix	620-629	10
β-strand	640-646	7	20
α-helix	649-654	6
β-strand	664-666	3	20
β-strand	670	1	22
α-helix	673-683	11
α-helix	688-698	11
β-strand	705	1	22
α-helix	707-713	7
α-helix	725-735	11

Chain C: 27 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	226-235	10
α-helix	242-248	7
β-strand	256-259	4	23
α-helix	267-276	10
β-strand	283-284	2	23
α-helix	287-290	4
α-helix	298-303	6
α-helix	307-316	10
β-strand	323-326	4	23
β-strand	340	1	24
α-helix	350-358	9
β-strand	367-373	7	23
α-helix	376-378	3
β-strand	391-394	4	23
α-helix	400-410	11
β-strand	420	1	25
α-helix	426-432	7
α-helix	438-452	15
β-strand	457-458	2	26
β-strand	464-465	2	26
α-helix	470-472	3
β-strand	475	1	25
α-helix	477-486	10
α-helix	496-498	3
α-helix	513-530	18
β-strand	536-542	7	27
α-helix	549-560	12
β-strand	566-568	3	27
α-helix	570-572	3
α-helix	578-590	13
α-helix	591-594	4
β-strand	600-602	3	27
α-helix	605-608	4
β-strand	612	1	28
β-strand	617	1	28
α-helix	620-629	10
α-helix	633-634	2
β-strand	640-646	7	27
α-helix	649-654	6
β-strand	664-666	3	27
β-strand	670	1	29
α-helix	673-683	11
α-helix	688-698	11
β-strand	705	1	29
α-helix	707-716	10
α-helix	725-736	12

Chain D: 28 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	216-218	3
α-helix	225-230	6
α-helix	231-235	5
α-helix	242-248	7
β-strand	255-259	5	30
α-helix	266-276	11
α-helix	280-283	4
β-strand	285-286	2	30
α-helix	287-290	4
α-helix	297-316	20
β-strand	323-328	6	30
α-helix	348-359	12
β-strand	367-373	7	30
α-helix	376-378	3
α-helix	381-383	3
β-strand	391-394	4	30
α-helix	400-406	7
β-strand	420	1	31
α-helix	426-429	4
α-helix	441-452	12
α-helix	453-456	4
β-strand	457-458	2	32
β-strand	464-465	2	32
β-strand	475	1	31
α-helix	477-486	10
β-strand	494	1	33
α-helix	513-530	18
β-strand	536-542	7	34
α-helix	550-558	9
β-strand	565	1	33
β-strand	566-568	3	34
α-helix	570-572	3
β-strand	576	1	24
α-helix	578-590	13
α-helix	591-594	4
β-strand	597	1	35
β-strand	600-602	3	34
α-helix	605-608	4
β-strand	612	1	36
β-strand	617	1	36
α-helix	620-629	10
β-strand	639	1	35
β-strand	640-646	7	34
α-helix	649-652	4
β-strand	664-666	3	34
β-strand	670	1	37
α-helix	673-683	11
α-helix	688-698	11
β-strand	705	1	37
α-helix	713-716	4
α-helix	725-736	12

Chain E: 34 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	225-234	10
α-helix	236-238	3
α-helix	242-248	7
α-helix	251-253	3
β-strand	256-259	4	38
α-helix	266-276	11
α-helix	281-282	2
β-strand	283-284	2	38
α-helix	287-291	5
α-helix	297-305	9
α-helix	307-315	9
α-helix	320-322	3
β-strand	323-326	4	38
α-helix	330-333	4
α-helix	347-358	12
β-strand	367-373	7	38
α-helix	376-378	3
α-helix	381-384	4
β-strand	391-394	4	38
α-helix	402-410	9
α-helix	413-416	4
β-strand	420	1	39
α-helix	426-432	7
α-helix	438-459	22
β-strand	475	1	39
α-helix	477-486	10
α-helix	512-514	3
α-helix	522-530	9
β-strand	536-542	7	40
α-helix	549-558	10
β-strand	566-568	3	40
α-helix	570-572	3
α-helix	580-590	11
α-helix	591-593	3
β-strand	600-602	3	40
α-helix	605-609	5
β-strand	612	1	41
β-strand	617	1	41
α-helix	620-629	10
β-strand	640-646	7	40
α-helix	649-652	4
α-helix	653-655	3
β-strand	664-666	3	40
β-strand	670	1	42
α-helix	673-683	11
α-helix	688-698	11
β-strand	705	1	42
α-helix	707-717	11
α-helix	722-724	3
α-helix	725-736	12

Chain F: 28 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	216-218	3
α-helix	224-233	10
β-strand	256-259	4	43
α-helix	267-276	10
α-helix	280-282	3
β-strand	283-286	4	43
α-helix	298-316	19
β-strand	323-328	6	43
α-helix	347-358	12
β-strand	367-373	7	43
α-helix	376-378	3
α-helix	382-384	3
β-strand	391-394	4	43
α-helix	400-410	11
α-helix	412-416	5
α-helix	426-431	6
α-helix	438-456	19
α-helix	477-486	10
α-helix	498-500	3
α-helix	512-527	16
β-strand	537-542	6	44
α-helix	549-558	10
β-strand	564-568	5	44
α-helix	570-572	3
α-helix	578-592	15
β-strand	597-602	6	44
α-helix	605-608	4
β-strand	612	1	45
β-strand	617	1	45
α-helix	620-629	10
α-helix	632-634	3
β-strand	639-645	7	44
α-helix	649-654	6
α-helix	658-660	3
β-strand	663-666	4	44
β-strand	670-672	3	46
α-helix	673-683	11
α-helix	688-698	11
β-strand	702-705	4	46
α-helix	708-718	11
α-helix	722-724	3
α-helix	727-736	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vesicle-fusing ATPase	A, B, C, D, E, F	protein	747	Cricetulus griseus	P18708 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9PFC_1 Vesicle-fusing ATPase (chains A, B, C, D, E, F)
GANMAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVP
GSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKM
AAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLV
VGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFAS
RVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGE
SEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSK
IDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGH
QLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTR
GDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLV
SVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQL
SCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEM
LNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMS
LQMDPEYRVRKFLALLREEGASPLDFD

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4
MG	Magnesium ion	Mg	7
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	5
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	7

Primary citation

Structural remodeling of target-SNARE protein complexes by NSF enables synaptic transmission. White, K.I., Khan, Y.A., Qiu, K. et al. Nat Commun (2025) 16:8371-8371. DOI 10.1038/s41467-025-62764-0 · PubMed

Other PDB entries of the same protein (UniProt P18708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D2N 1.75 Å, D2 domain of N-ethylmaleimide-sensitive fusion protein
1NSF 1.9 Å, D2 hexamerization domain of N-ethylmaleimide sensitive factor (NSF)
1QCS 1.9 Å, N-terminal domain of N-ethylmaleimide sensitive factor (NSF)
1QDN 2.3 Å, Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
9OK5 3.29 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 16
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5
9PB9 3.45 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 8
9PBA 3.47 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 9
9OLJ 3.52 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18

Browse structure collections

About this viewer

MolViewer shows 9PFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.