1NZ6: Auxilin J-Domain

Crystal Structure of Auxilin J-Domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Apr 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Bos taurus
Chains: 2
Atoms: 1,637
Mol. weight: 24.05 kDa
Released: 22 Apr 2003

Explore 1NZ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NZ6 contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-11	10
α-helix	18-22	5
α-helix	25-27	3
α-helix	30	1
α-helix	41-43	3
α-helix	47-60	14
α-helix	63-66	4
α-helix	72-90	19

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	102-114	13
α-helix	118-123	6
α-helix	125-127	3
α-helix	129-130	2
α-helix	141-143	3
α-helix	147-161	15
α-helix	163-166	4
α-helix	172-191	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Auxilin	A, B	protein	101	Bos taurus	Q27974 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1NZ6_1 Auxilin (chains A, B)
KEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKA
VLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY

Primary citation

Structure-function analysis of the auxilin J-domain reveals an extended Hsc70 interaction interface. Jiang, J., Taylor, A.B., Prasad, K. et al. Biochemistry (2003) 42:5748-5753. DOI 10.1021/bi034270g · PubMed

Other PDB entries of the same protein (UniProt Q27974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QWO 1.7 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
2QWP 1.75 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
3N0A 2.2 Å, Crystal structure of auxilin (40-400)
2QWQ 2.21 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
2QWR 2.21 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
2QWN 2.4 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)R171C…
1XI5 12.0 Å, Clathrin D6 coat with auxilin J-domain
1N4C NMR Structure of the J-Domain and Clathrin Substrate Binding Domain of Bovine Auxilin

Browse structure collections

About this viewer

MolViewer shows 1NZ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.