Crystal structure of SH2 in complex with malonicacid. Determined by X-ray diffraction at 1.6 Å resolution. Released 17 Feb 2004.
Explore 1O4M in 3D Show helices and sheets RCSB PDB PDBe
1O4M contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-10 | 3 | 1 |
| α-helix | 14-21 | 8 | |
| α-helix | 26-27 | 2 | |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 43-51 | 9 | 1 |
| β-strand | 55-63 | 9 | 1 |
| β-strand | 64-65 | 2 | 2 |
| β-strand | 71-72 | 2 | 2 |
| β-strand | 78-79 | 2 | 2 |
| α-helix | 82-89 | 8 | |
| β-strand | 103 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase src | A | protein | 108 | Homo sapiens | P12931 (AlphaFold model) |
>1O4M_1 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC (chains A) SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLA | Malonic acid | C3 H4 O4 | 1 |
Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors. Lange, G., Lesuisse, D., Deprez, P. et al. J Med Chem (2003) 46:5184-5195. DOI 10.1021/jm020970s · PubMed
Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1O4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.