8VCF: PDB entry 8VCF

Crystal structure of Superbinder Src SH2 domain with Cysteine to Serine mutations. Determined by X-ray diffraction at 1.5 Å resolution. Released 29 Jan 2025.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 978
Mol. weight: 14.41 kDa
Released: 29 Jan 2025

Explore 8VCF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VCF contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	146-148	3
β-strand	152-154	3	1
α-helix	158-165	8
α-helix	171	1
β-strand	174-179	6	1
β-strand	187-195	9	1
β-strand	199-207	9	1
β-strand	208-209	2	2
β-strand	215-218	4	2
β-strand	221-223	3	2
α-helix	226-235	10
β-strand	238	1	3
β-strand	240	1	3
β-strand	246-247	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 3 of Proto-oncogene tyrosine-protein kinase Src	A	protein	127	Homo sapiens	P12931 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8VCF_1 Isoform 3 of Proto-oncogene tyrosine-protein kinase Src (chains A)
MGSSHHHHHHGLVPRGSHMDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVK
GAYALSVSDFDNAKGLNVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLSHRL
TTVSPTS

Primary citation

Engineered Mutant Src Sh2 Domain. Hashem, A., Nyovanie, S., Patskovsky, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFX 1.45 Å, Crystal structure of c-Src SH3 domain in H32 space group mediated by nickel
1FMK 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src
1O43 1.5 Å, Crystal structure of SH2 in complex with RU82129.
1O4A 1.5 Å, Crystal structure of SH2 in complex with RU82197.
1O4R 1.5 Å, Crystal structure of SH2 in complex with RU78783.
2SRC 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp
6C4S 1.5 Å, Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69
7NG7 1.5 Å, Src kinase bound to eCF506 trapped in inactive conformation
1O48 1.55 Å, Crystal structure of SH2 in complex with RU85053.
1O4G 1.55 Å, Crystal structure of SH2 in complex with DPI59.
1O4K 1.57 Å, Crystal structure of SH2 in complex with pasbn.
4F5B 1.57 Å, Triple mutant Src SH2 domain bound to phosphotyrosine

Browse structure collections

About this viewer

MolViewer shows 8VCF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.