2SRC: Human tyrosine-protein kinase C-src

Name: PDB 2SRC: Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp
Published: 1999-07-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: tyrosine-protein kinase

Crystal structure of human tyrosine-protein kinase C-src, in complex with AMP-pnp. Determined by X-ray diffraction at 1.5 Å resolution. Released 22 Jul 1999.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,915
Mol. weight: 52.22 kDa
Ligands: ANP
Released: 22 Jul 1999

Explore 2SRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2SRC contains 26 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	1
β-strand	92	1	2
β-strand	99	1	1
β-strand	102	1	2
β-strand	107-112	6	1
β-strand	118-123	6	1
β-strand	129-133	5	1
α-helix	134-136	3
β-strand	137-139	3	1
β-strand	149	1	3
α-helix	155-162	8
α-helix	167-168	2
β-strand	171-176	6	3
β-strand	184-192	9	3
β-strand	196-204	9	3
β-strand	205-206	2	4
β-strand	212-213	2	4
β-strand	219-220	2	4
α-helix	223-229	7
β-strand	243-244	2	3
α-helix	245-246	2
α-helix	248-252	5
β-strand	261	1	5
α-helix	264-266	3
β-strand	267-275	9	5
β-strand	279-286	8	5
β-strand	290-297	8	5
α-helix	304-315	12
β-strand	322	1	6
α-helix	323-324	2
β-strand	325-329	5	5
α-helix	334	1
β-strand	335-338	4	5
β-strand	345	1	6
α-helix	346-350	5
α-helix	360-379	20
α-helix	389-391	3
β-strand	392-395	4	6
α-helix	396-398	3
β-strand	399-402	4	6
α-helix	407-410	4
α-helix	414-417	4
α-helix	426-428	3
α-helix	431-436	6
α-helix	441-455	15
α-helix	460-461	2
α-helix	468-476	9
α-helix	481-484	4
α-helix	489-498	10
α-helix	503-505	3
α-helix	507-508	2
α-helix	509-517	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase src	A	protein	452	Homo sapiens	P12931 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2SRC_1 TYROSINE-PROTEIN KINASE SRC (chains A)
MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKH
YKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWE
IPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEK
LVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMN
YVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTI
KSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRK
EPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Crystal structures of c-Src reveal features of its autoinhibitory mechanism. Xu, W., Doshi, A., Lei, M. et al. Mol Cell (1999) 3:629-638. DOI 10.1016/S1097-2765(00)80356-1 · PubMed

Other PDB entries of the same protein (UniProt P12931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFX 1.45 Å, Crystal structure of c-Src SH3 domain in H32 space group mediated by nickel
1FMK 1.5 Å, Crystal structure of human tyrosine-protein kinase C-src
1O43 1.5 Å, Crystal structure of SH2 in complex with RU82129.
1O4A 1.5 Å, Crystal structure of SH2 in complex with RU82197.
1O4R 1.5 Å, Crystal structure of SH2 in complex with RU78783.
6C4S 1.5 Å, Human cSrc SH3 Domain in complex with Choline Kinase fragment 60-69
7NG7 1.5 Å, Src kinase bound to eCF506 trapped in inactive conformation
8VCF 1.5 Å, Crystal structure of Superbinder Src SH2 domain with Cysteine to Serine mutations
1O48 1.55 Å, Crystal structure of SH2 in complex with RU85053.
1O4G 1.55 Å, Crystal structure of SH2 in complex with DPI59.
1O4K 1.57 Å, Crystal structure of SH2 in complex with pasbn.
4F5B 1.57 Å, Triple mutant Src SH2 domain bound to phosphotyrosine

Browse structure collections

About this viewer

MolViewer shows 2SRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.