Internalin (Listeria monocytogenes) / E-Cadherin (human) Recognition Complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Dec 2002.
Explore 1O6S in 3D Show helices and sheets RCSB PDB PDBe
1O6S contains 22 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-43 | 2 | 1 |
| α-helix | 44-47 | 4 | |
| α-helix | 51-60 | 10 | |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 72-75 | 4 | |
| β-strand | 80-82 | 3 | 2 |
| α-helix | 94-96 | 3 | |
| β-strand | 102-104 | 3 | 2 |
| α-helix | 114-116 | 3 | |
| β-strand | 124-126 | 3 | 2 |
| α-helix | 136-138 | 3 | |
| β-strand | 146-148 | 3 | 2 |
| α-helix | 158-160 | 3 | |
| β-strand | 168-176 | 9 | 2 |
| α-helix | 180-182 | 3 | |
| β-strand | 190-195 | 6 | 2 |
| α-helix | 201-203 | 3 | |
| β-strand | 211-213 | 3 | 2 |
| α-helix | 223-227 | 5 | |
| β-strand | 233-235 | 3 | 2 |
| α-helix | 245-249 | 5 | |
| β-strand | 255-257 | 3 | 2 |
| α-helix | 267-271 | 5 | |
| β-strand | 277-279 | 3 | 2 |
| α-helix | 289-291 | 3 | |
| β-strand | 299-301 | 3 | 2 |
| α-helix | 311-313 | 3 | |
| β-strand | 321-323 | 3 | 2 |
| α-helix | 333-337 | 5 | |
| β-strand | 343-345 | 3 | 2 |
| α-helix | 355-359 | 5 | |
| β-strand | 365-367 | 3 | 2 |
| α-helix | 377-381 | 5 | |
| β-strand | 387-389 | 3 | 2 |
| β-strand | 397 | 1 | 3 |
| α-helix | 399-401 | 3 | |
| β-strand | 409-411 | 3 | 2 |
| β-strand | 415-418 | 4 | 4 |
| β-strand | 422 | 1 | 5 |
| β-strand | 429-431 | 3 | 6 |
| β-strand | 435 | 1 | 3 |
| α-helix | 440 | 1 | |
| β-strand | 441 | 1 | 3 |
| α-helix | 442-444 | 3 | |
| β-strand | 446-447 | 2 | 4 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-454 | 3 | 6 |
| β-strand | 457-459 | 3 | 6 |
| β-strand | 468-479 | 12 | 4 |
| β-strand | 482-493 | 12 | 4 |
| β-strand | 494 | 1 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 7 |
| β-strand | 7-10 | 4 | 8 |
| β-strand | 19-23 | 5 | 9 |
| β-strand | 25-26 | 2 | 7 |
| α-helix | 27-30 | 4 | |
| β-strand | 34-40 | 7 | 8 |
| β-strand | 41 | 1 | 10 |
| β-strand | 45 | 1 | 10 |
| β-strand | 51-53 | 3 | 9 |
| β-strand | 59-62 | 4 | 9 |
| β-strand | 73-82 | 10 | 8 |
| β-strand | 87 | 1 | 8 |
| β-strand | 92-99 | 8 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Internalin a | A | protein | 466 | LISTERIA MONOCYTOGENES | P0DJM0 (AlphaFold model) |
| E-cadherin | B | protein | 105 | HOMO SAPIENS | P12830 (AlphaFold model) |
>1O6S_1 INTERNALIN A (chains A) GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKS IDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLF NNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLE RLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLA SLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLE DISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSA GHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDG GSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA
>1O6S_2 E-CADHERIN (chains B) GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (CL) are not listed.
Structure of Internalin, a Major Invasion Protein of Listeria Monocytogenes, in Complex with its Human Receptor E-Cadherin. Schubert, W.-D., Urbanke, C., Ziehm, T. et al. Cell (2002) 111:825. DOI 10.1016/S0092-8674(02)01136-4 · PubMed
Other PDB entries of the same protein (UniProt P0DJM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1O6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.