Crystal structure of Internalin A from Listeria monocytogenes with nanobody VHH10 bound. Determined by X-ray diffraction at 1.53 Å resolution. Released 4 Oct 2023.
Explore 8H63 in 3D Show helices and sheets RCSB PDB PDBe
8H63 contains 24 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-43 | 2 | 1 |
| α-helix | 44-47 | 4 | |
| α-helix | 51-60 | 10 | |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 72-76 | 5 | |
| β-strand | 80-82 | 3 | 2 |
| α-helix | 94-96 | 3 | |
| β-strand | 102-104 | 3 | 2 |
| α-helix | 114-116 | 3 | |
| β-strand | 124-126 | 3 | 2 |
| α-helix | 136-138 | 3 | |
| β-strand | 146-148 | 3 | 2 |
| α-helix | 158-160 | 3 | |
| β-strand | 168-176 | 9 | 2 |
| α-helix | 180-182 | 3 | |
| β-strand | 190-195 | 6 | 2 |
| α-helix | 201-203 | 3 | |
| β-strand | 211-213 | 3 | 2 |
| α-helix | 223-227 | 5 | |
| β-strand | 233-235 | 3 | 2 |
| α-helix | 245-249 | 5 | |
| β-strand | 255-257 | 3 | 2 |
| α-helix | 267-271 | 5 | |
| β-strand | 277-279 | 3 | 2 |
| α-helix | 289-291 | 3 | |
| β-strand | 299-301 | 3 | 2 |
| α-helix | 311-313 | 3 | |
| β-strand | 321-323 | 3 | 2 |
| α-helix | 333-337 | 5 | |
| β-strand | 343-345 | 3 | 2 |
| α-helix | 355-359 | 5 | |
| β-strand | 365-367 | 3 | 2 |
| α-helix | 377-379 | 3 | |
| β-strand | 387-389 | 3 | 2 |
| β-strand | 397 | 1 | 3 |
| α-helix | 399-401 | 3 | |
| β-strand | 409-411 | 3 | 2 |
| β-strand | 412-418 | 7 | 4 |
| α-helix | 419-421 | 3 | |
| β-strand | 422-423 | 2 | 5 |
| β-strand | 427-431 | 5 | 6 |
| β-strand | 435 | 1 | 3 |
| α-helix | 440 | 1 | |
| β-strand | 441 | 1 | 3 |
| α-helix | 442-444 | 3 | |
| β-strand | 446-447 | 2 | 4 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-454 | 3 | 6 |
| β-strand | 457-461 | 5 | 6 |
| β-strand | 468-479 | 12 | 4 |
| β-strand | 482-493 | 12 | 4 |
| β-strand | 494-495 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 10-13 | 4 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 27-31 | 5 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 46-51 | 6 | 8 |
| β-strand | 57-59 | 3 | 8 |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-98 | 8 | 8 |
| β-strand | 114-119 | 6 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Internalin A | A | protein | 462 | Listeria monocytogenes serovar 1/2a | P0DJM0 (AlphaFold model) |
| VHH10 | B | protein | 120 | Lama glama |
>8H63_1 Internalin A (chains A) SATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGV EYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQI TDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDI SSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTN LTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISP ISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQ ISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYT EPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA
>8H63_2 VHH10 (chains B) ELQLVESGGGLVQAGGSLTVSCAASGSAFSVNVMGWSRQAPGKERELVAGITRRGNTYYA DTVKGRFTISRDNAKNTLYLQMNSLKPEDTAMYYCAALADIATMGPNDYWGQGTQVTVSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Water and common crystallization additives (EPE, GOL, NA) are not listed.
Anti-InlA single-domain antibodies that inhibit the cell invasion of Listeria monocytogenes. Yamazaki, T., Nagatoishi, S., Yamawaki, T. et al. J Biol Chem (2023) 299:105254-105254. DOI 10.1016/j.jbc.2023.105254 · PubMed
Other PDB entries of the same protein (UniProt P0DJM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8H63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.