Crystal structure of InlA S192N Y369S/hEC1 complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Jun 2007.
Explore 2OMV in 3D Show helices and sheets RCSB PDB PDBe
2OMV contains 22 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-43 | 2 | 1 |
| α-helix | 44-47 | 4 | |
| α-helix | 51-60 | 10 | |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 72-76 | 5 | |
| β-strand | 80-82 | 3 | 2 |
| α-helix | 94-96 | 3 | |
| β-strand | 102-104 | 3 | 2 |
| α-helix | 114-116 | 3 | |
| β-strand | 124-126 | 3 | 2 |
| α-helix | 136-138 | 3 | |
| β-strand | 146-148 | 3 | 2 |
| α-helix | 158-160 | 3 | |
| β-strand | 168-176 | 9 | 2 |
| α-helix | 180-182 | 3 | |
| β-strand | 190-195 | 6 | 2 |
| α-helix | 201-203 | 3 | |
| β-strand | 211-213 | 3 | 2 |
| α-helix | 223-227 | 5 | |
| β-strand | 233-235 | 3 | 2 |
| α-helix | 245-249 | 5 | |
| β-strand | 255-257 | 3 | 2 |
| α-helix | 267-271 | 5 | |
| β-strand | 277-279 | 3 | 2 |
| α-helix | 289-291 | 3 | |
| β-strand | 299-301 | 3 | 2 |
| α-helix | 311-313 | 3 | |
| β-strand | 321-323 | 3 | 2 |
| α-helix | 333-337 | 5 | |
| β-strand | 343-345 | 3 | 2 |
| α-helix | 355-359 | 5 | |
| β-strand | 365-367 | 3 | 2 |
| α-helix | 377-381 | 5 | |
| β-strand | 387-389 | 3 | 2 |
| β-strand | 397 | 1 | 3 |
| α-helix | 399-401 | 3 | |
| β-strand | 409-411 | 3 | 2 |
| β-strand | 415-418 | 4 | 4 |
| α-helix | 419-421 | 3 | |
| β-strand | 422 | 1 | 5 |
| β-strand | 429-431 | 3 | 6 |
| β-strand | 435 | 1 | 3 |
| α-helix | 440 | 1 | |
| β-strand | 441 | 1 | 3 |
| α-helix | 442-444 | 3 | |
| β-strand | 446-447 | 2 | 4 |
| β-strand | 452-454 | 3 | 6 |
| β-strand | 457-459 | 3 | 6 |
| β-strand | 468-479 | 12 | 4 |
| β-strand | 482-493 | 12 | 4 |
| β-strand | 494 | 1 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 7 |
| β-strand | 7-10 | 4 | 8 |
| β-strand | 19-23 | 5 | 9 |
| β-strand | 25-26 | 2 | 7 |
| α-helix | 27-30 | 4 | |
| β-strand | 35-40 | 6 | 8 |
| β-strand | 41 | 1 | 10 |
| β-strand | 45 | 1 | 10 |
| β-strand | 51-53 | 3 | 9 |
| β-strand | 59-62 | 4 | 9 |
| β-strand | 73-81 | 9 | 8 |
| β-strand | 87 | 1 | 8 |
| β-strand | 92-99 | 8 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Internalin-A | A | protein | 461 | Listeria monocytogenes | P0DJM0 (AlphaFold model) |
| Epithelial-cadherin | B | protein | 105 | Homo sapiens | P12830 (AlphaFold model) |
>2OMV_1 Internalin-A (chains A) ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVE YLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQIT DIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLNFGNQVTDLKPLANLTTLERLDIS SNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNL TDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPI SNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNINWLSAGHNQI SDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTE PDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA
>2OMV_2 Epithelial-cadherin (chains B) GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (CL) are not listed.
Extending the host range of Listeria monocytogenes by rational protein design. Wollert, T., Pasche, B., Rochon, M. et al. Cell (2007) 129:891-902. DOI 10.1016/j.cell.2007.03.049 · PubMed
Other PDB entries of the same protein (UniProt P0DJM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OMV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.