1O7Y: IP-10 M-form

Name: PDB 1O7Y: Crystal structure of IP-10 M-form
Published: 2003-05-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chemokine

Crystal structure of IP-10 M-form. Determined by X-ray diffraction at 3.0 Å resolution. Released 8 May 2003.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,969
Mol. weight: 34.74 kDa
Released: 8 May 2003

Explore 1O7Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O7Y contains 11 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	15	1	2
α-helix	21-23	3
β-strand	24	1	3
β-strand	28-30	3	2
β-strand	33	1	4
β-strand	36	1	4
β-strand	40-44	5	2
β-strand	45	1	3
β-strand	51-54	4	2
α-helix	59-62	4

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	2
β-strand	33	1	5
β-strand	36	1	5
β-strand	41-45	5	2
α-helix	47-49	3
β-strand	51-54	4	2
α-helix	60-62	3
α-helix	64-67	4

Chain C: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	15	1	6
α-helix	18-19	2
β-strand	24-30	7	6
β-strand	40-45	6	6
α-helix	47-49	3
β-strand	51-54	4	6
α-helix	60-66	7

Chain D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	6
β-strand	33	1	7
β-strand	36	1	7
β-strand	40-45	6	6
α-helix	47-49	3
β-strand	51-54	4	6
α-helix	59-67	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small inducible cytokine B10	A, B, C, D	protein	77	HOMO SAPIENS	P02778 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1O7Y_1 SMALL INDUCIBLE CYTOKINE B10 (chains A, B, C, D)
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKEMSKRSP

Primary citation

Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine. Swaminathan, G.J., Holloway, D.E., Colvin, R.A. et al. Structure (2003) 11:521. DOI 10.1016/S0969-2126(03)00070-4 · PubMed

Other PDB entries of the same protein (UniProt P02778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1O7Z 1.92 Å, Crystal structure of IP-10 T-form
1O80 2.0 Å, Crystal structure of IP-10 H-Form
9P0L 3.1 Å, Composite map of CXCL10-CXCR3-Gi-scFv16
8K2X 3.2 Å, CXCR3-DNGi complex activated by CXCL10
1LV9 CXCR3 Binding Chemokine IP-10/CXCL10

Browse structure collections

About this viewer

MolViewer shows 1O7Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.