1OJY: Complement decay-accelerating factor

Decay accelerating factor (cd55): the structure of an intact human complement regulator. Determined by X-ray diffraction at 2.6 Å resolution. Released 7 Jan 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 8,050
Mol. weight: 113.78 kDa
Released: 7 Jan 2004

Explore 1OJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OJY contains 48 α-helices and 150 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	7-9	3
β-strand	13-15	3	2
β-strand	23-24	2	1
β-strand	28-30	3	3
β-strand	31-33	3	2
β-strand	37-39	3	4
α-helix	40	1
β-strand	46-48	3	3
β-strand	49-50	2	5
β-strand	54-55	2	5
α-helix	56-57	2
β-strand	62-64	3	4
β-strand	65	1	6
α-helix	66-67	2
β-strand	75-77	3	7
α-helix	78	1
α-helix	81-83	3
β-strand	88	1	6
β-strand	92-94	3	8
β-strand	95-97	3	7
β-strand	101-103	3	9
β-strand	110-112	3	8
β-strand	113	1	10
β-strand	119	1	10
α-helix	120-122	3
β-strand	126-128	3	9
α-helix	129	1
β-strand	130	1	11
α-helix	131-133	3
β-strand	140-144	5	12
β-strand	149	1	11
β-strand	153-158	6	12
β-strand	162-165	4	13
β-strand	169-171	3	12
β-strand	172-175	4	14
β-strand	178-181	4	14
β-strand	187-190	4	13
α-helix	191	1
β-strand	192	1	15
α-helix	193-198	6
β-strand	202-205	4	16
β-strand	212	1	15
β-strand	216-221	6	16
β-strand	226-228	3	17
β-strand	232-234	3	16
β-strand	235-236	2	18
β-strand	243-244	2	18
β-strand	250-252	3	17

Chain B: 11 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	19
α-helix	7-9	3
β-strand	13-15	3	20
β-strand	23-24	2	19
β-strand	28-30	3	21
β-strand	31-33	3	20
β-strand	37-39	3	22
α-helix	40	1
β-strand	46-48	3	21
β-strand	49-50	2	23
β-strand	54-55	2	23
α-helix	56-57	2
β-strand	62-64	3	22
β-strand	65	1	24
α-helix	66-67	2
β-strand	75-77	3	25
α-helix	78	1
α-helix	81-83	3
β-strand	88	1	24
β-strand	92-94	3	26
β-strand	95-97	3	25
β-strand	101-103	3	27
β-strand	110-112	3	26
β-strand	113	1	28
β-strand	119	1	28
α-helix	120-122	3
β-strand	126-128	3	27
α-helix	129	1
β-strand	130	1	29
α-helix	131-133	3
β-strand	140-144	5	30
β-strand	149	1	29
β-strand	153-158	6	30
β-strand	162-165	4	31
β-strand	169-171	3	30
β-strand	172-175	4	32
β-strand	178-181	4	32
β-strand	187-190	4	31
β-strand	192	1	33
α-helix	193-198	6
β-strand	202-205	4	34
β-strand	212	1	33
β-strand	216-221	6	34
β-strand	226-228	3	35
β-strand	232-234	3	34
β-strand	235-236	2	36
β-strand	243-244	2	36
α-helix	247-249	3
β-strand	250-252	3	35

Chain C: 13 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	37
α-helix	7-9	3
β-strand	13-15	3	38
β-strand	23-24	2	37
β-strand	28-30	3	39
β-strand	31-33	3	38
α-helix	34	1
β-strand	37-39	3	40
α-helix	40	1
β-strand	46-48	3	39
β-strand	49-50	2	41
β-strand	54-55	2	41
α-helix	56-57	2
β-strand	62-64	3	40
β-strand	75-77	3	42
α-helix	78	1
β-strand	92-94	3	43
β-strand	95-97	3	42
α-helix	98	1
β-strand	101-103	3	44
β-strand	110-112	3	43
β-strand	113	1	45
β-strand	119	1	45
α-helix	120-122	3
β-strand	126-128	3	44
α-helix	129	1
β-strand	130	1	46
α-helix	131-133	3
β-strand	140-143	4	47
β-strand	149	1	46
β-strand	153-158	6	47
β-strand	162-165	4	48
β-strand	169-171	3	47
β-strand	172-175	4	49
β-strand	178-181	4	49
β-strand	187-190	4	48
α-helix	191	1
β-strand	192	1	50
α-helix	193-198	6
β-strand	202-205	4	51
β-strand	212	1	50
β-strand	216-221	6	51
α-helix	222	1
β-strand	226-228	3	52
β-strand	229-230	2	12
β-strand	232-234	3	51
β-strand	235-236	2	53
β-strand	243-244	2	53
α-helix	247-249	3
β-strand	250-252	3	52

Chain D: 13 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	54
α-helix	7-9	3
β-strand	13-15	3	55
β-strand	23-24	2	54
β-strand	28-30	3	56
β-strand	31-33	3	55
α-helix	34	1
β-strand	37-39	3	57
α-helix	40	1
β-strand	46-48	3	56
β-strand	49-50	2	58
β-strand	54-55	2	58
α-helix	56-57	2
β-strand	62-64	3	57
β-strand	75-77	3	59
α-helix	78	1
β-strand	92-94	3	60
β-strand	95-97	3	59
α-helix	98	1
β-strand	101-103	3	61
β-strand	110-112	3	60
β-strand	113	1	62
β-strand	119	1	62
α-helix	120-122	3
β-strand	126-128	3	61
α-helix	129	1
β-strand	130	1	63
α-helix	131-133	3
β-strand	140-143	4	64
β-strand	149	1	63
β-strand	153-158	6	64
β-strand	162-165	4	65
β-strand	169-171	3	64
β-strand	172-175	4	66
β-strand	178-181	4	66
β-strand	187-190	4	65
α-helix	191	1
β-strand	192	1	67
α-helix	193-198	6
β-strand	202-205	4	68
β-strand	212	1	67
β-strand	216-221	6	68
α-helix	222	1
β-strand	225-228	4	69
β-strand	229-230	2	30
β-strand	232-234	3	68
β-strand	235-236	2	70
β-strand	243-244	2	70
α-helix	247-249	3
β-strand	250-253	4	69

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement decay-accelerating factor	A, B, C, D	protein	254	HOMO SAPIENS	P08174 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1OJY_1 COMPLEMENT DECAY-ACCELERATING FACTOR (chains A, B, C, D)
MQDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEE
FCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWS
TAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQ
WSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNND
EGEWSGPPPECRGC

Primary citation

Complement Regulation at the Molecular Level: The Structure of Decay-Accelerating Factor. Lukacik, P., Roversi, P., White, J. et al. Proc Natl Acad Sci U S A (2004) 101:1279. DOI 10.1073/PNAS.0307200101 · PubMed

Other PDB entries of the same protein (UniProt P08174 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1H03 1.7 Å, Human CD55 domains 3 & 4
1H04 2.0 Å, Human CD55 domains 3 & 4
1OK3 2.2 Å, Decay accelerating factor (cd55): the structure of an intact human complement regulator.
1OJV 2.3 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OJW 2.3 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OK2 2.5 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OK1 2.6 Å, Decay accelerating factor (cd55) : the structure of an intact human complement regulator.
8K9T 2.66 Å, Cryo-EM structure of the products-bound PGAP1(Bst1)-S327A from Chaetonium thermophilum
8K9R 2.68 Å, Cryo EM structure of the products-bound PGAP1(Bst1)-H443N from Chaetomium thermophilum
1H2P 2.8 Å, Human CD55 domains 3 & 4
6LA5 2.86 Å, Cryo-EM structure of echovirus 11 complexed with its attaching receptor CD55 at pH 7.4
1H2Q 3.0 Å, Human CD55 domains 3 & 4

Browse structure collections

About this viewer

MolViewer shows 1OJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.