1OLN: 50S ribosomal protein L11

Model for thiostrepton antibiotic binding to L11 substrate from 50S ribosomal RNA. Determined by solution NMR. Released 11 Sept 2003.

Method: Solution NMR
Organisms: THERMOTOGA MARITIMA, STREPTOMYCES AZUREUS
Chains: 3
Atoms: 2,350
Mol. weight: 35.48 kDa
Released: 11 Sept 2003

Explore 1OLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OLN contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-14	6	1
α-helix	26-29	4
α-helix	35-45	11
β-strand	53-60	8	1
β-strand	66-70	5	1
α-helix	72-74	3
α-helix	75-83	9
β-strand	98-100	3	2
α-helix	102-112	11
α-helix	113-115	3
α-helix	121-132	12
β-strand	137-139	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L11	A	protein	140	THERMOTOGA MARITIMA	P29395 (AlphaFold model)
Thiostrepton	B	protein	19	STREPTOMYCES AZUREUS	P0C8P8 (AlphaFold model)
RNA	C	RNA	58	THERMOTOGA MARITIMA

Sequence of entity 1 (A), FASTA

>1OLN_1 50S RIBOSOMAL PROTEIN L11 (chains A)
AKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVY
EDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSL
EAAMKIIEGTAKSMGIEVVD

Sequence of entity 2 (B), FASTA

>1OLN_2 THIOSTREPTON (chains B)
XIASASCTTCICTCSCSSX

Sequence of entity 3 (C), FASTA

>1OLN_3 RNA (chains C)
GCUGGGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAGUGCGUAACAGCUCACCAGC

Primary citation

Structural Basis for Contrasting Activities of Ribosome Binding Thiazole Antibiotics. Lentzen, G., Klinck, R., Matassova, N. et al. Chem Biol (2003) 10:769. DOI 10.1016/S1074-5521(03)00173-X · PubMed

Other PDB entries of the same protein (UniProt P29395 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MMS 2.57 Å, Crystal structure of the ribosomal PROTEIN L11-RNA complex
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1R2W 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
1R2X 9.0 Å, Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary…
1PN7 10.8 Å, Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the…
1PN8 10.8 Å, Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1EG0 11.5 Å, Fitting of components with known structure into an 11.5 a cryo-EM map of the e.coli 70S…

Browse structure collections

About this viewer

MolViewer shows 1OLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.