Histidine-containing protein (HPR), mutant with ser 46 replaced by asp (S46D). Determined by X-ray diffraction at 1.5 Å resolution. Released 20 Aug 1997.
Explore 1OPD in 3D Show helices and sheets RCSB PDB PDBe
1OPD contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| α-helix | 16-27 | 12 | |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 40-43 | 4 | 1 |
| α-helix | 47-52 | 6 | |
| β-strand | 60-66 | 7 | 1 |
| α-helix | 70-83 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histidine-containing protein | A | protein | 85 | Escherichia coli | P0AA04 (AlphaFold model) |
>1OPD_1 HISTIDINE-CONTAINING PROTEIN (chains A) MFEQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKDLFKLQTLGLTQGTV VTISAEGEDEQKAVEHLVKLMAELE
Mutation of serine-46 to aspartate in the histidine-containing protein of Escherichia coli mimics the inactivation by phosphorylation of serine-46 in HPrs from gram-positive bacteria. Napper, S., Anderson, J.W., Georges, F. et al. Biochemistry (1996) 35:11260-11267. DOI 10.1021/bi9603480 · PubMed
Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OPD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.