1OW1: SMART/HDAC1 associated repressor protein

Name: PDB 1OW1: Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP.
Published: 2003-08-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Aug 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,368
Mol. weight: 21.33 kDa
Released: 19 Aug 2003

Explore 1OW1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OW1 contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3501-3504	4
β-strand	3507-3515	9	1
β-strand	3518-3529	12	1
α-helix	3531-3537	7
α-helix	3539-3540	2
β-strand	3547-3549	3	1
β-strand	3551-3554	4	1
α-helix	3557-3566	10
β-strand	3573-3580	8	1
α-helix	3585-3594	10
α-helix	3595-3600	6
α-helix	3601-3606	6
β-strand	3608-3614	7	1
α-helix	3615-3616	2
β-strand	3624-3629	6	1
α-helix	3630	1
α-helix	3633-3642	10
α-helix	3644-3650	7
β-strand	3657-3663	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMART/HDAC1 associated repressor protein	A	protein	195	Homo sapiens	Q96T58

Sequence of entity 1 (A), FASTA

>1OW1_1 SMART/HDAC1 associated repressor protein (chains A)
GLVLPHTEFQPAPKQDSSPHLTSQRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSG
NNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVV
SQTESLKAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLAS
ISNISPHLMIVIASV

Primary citation

A conserved structural motif reveals the essential transcriptional repression function of Spen proteins and their role in developmental signaling. Schwabe, J.W., Ariyoshi, M. Genes Dev (2003) 17:1909-1920. DOI 10.1101/gad.266203 · PubMed

Other PDB entries of the same protein (UniProt Q96T58), best resolution first:

7Z1K 1.55 Å, Crystal structure of the SPOC domain of human SHARP (SPEN) in complex with RNA…
4P6Q 2.0 Å, The crystal structure of the Split End protein SHARP adds a new layer of complexity to…
2RT5 Structural insights into the recruitment of SMRT by the co-repressor SHARP under…

Browse structure collections

About this viewer

MolViewer shows 1OW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.