Paxillin LD2 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase. Determined by X-ray diffraction at 2.85 Å resolution. Released 21 Oct 2003.
Explore 1OW8 in 3D Show helices and sheets RCSB PDB PDBe
1OW8 contains 22 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 923-941 | 19 | |
| α-helix | 947-971 | 25 | |
| α-helix | 972-974 | 3 | |
| α-helix | 977-979 | 3 | |
| α-helix | 980-1006 | 27 | |
| α-helix | 1013-1046 | 34 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 911 | 1 | |
| α-helix | 914 | 1 | |
| α-helix | 923-941 | 19 | |
| α-helix | 947-969 | 23 | |
| α-helix | 972-974 | 3 | |
| α-helix | 977-979 | 3 | |
| α-helix | 980-1006 | 27 | |
| α-helix | 1013-1045 | 33 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 910-911 | 2 | |
| α-helix | 923-940 | 18 | |
| α-helix | 947-969 | 23 | |
| α-helix | 977-979 | 3 | |
| α-helix | 980-1006 | 27 | |
| α-helix | 1011-1046 | 36 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-12 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A, B, C | protein | 161 | Homo sapiens | Q05397 (AlphaFold model) |
| Paxillin | D, F | protein | 13 | P49023 (AlphaFold model) |
>1OW8_1 Focal adhesion kinase 1 (chains A, B, C) SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYV PMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTS LQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
>1OW8_2 Paxillin (chains D, F) NLSELDRLLLELN
Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain. Hoellerer, M.K., Noble, M.E.M., Labesse, G. et al. Structure (2003) 11:1207-1217. DOI 10.1016/j.str.2003.08.010 · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.