1P27: Human Y14/Magoh complex

Crystal Structure of the Human Y14/Magoh complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Aug 2003.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,966
Mol. weight: 58.17 kDa
Released: 19 Aug 2003

Explore 1P27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P27 contains 22 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-16	12	1
β-strand	18-26	9	1
β-strand	31-38	8	1
β-strand	44-52	9	1
α-helix	54-67	14
α-helix	69-71	3
α-helix	78-79	2
β-strand	85-92	8	1
β-strand	95-101	7	1
α-helix	102-104	3
α-helix	107-110	4
α-helix	116-141	26

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	66	1	1
β-strand	69	1	2
β-strand	72	1	2
β-strand	73-78	6	3
α-helix	86-93	8
α-helix	94-96	3
β-strand	99-106	8	3
α-helix	107	1
β-strand	113-121	9	3
α-helix	124-134	11
β-strand	138	1	4
β-strand	143	1	4
β-strand	145-148	4	3
β-strand	150-151	2	1

Chain C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	11	5
β-strand	18-26	9	5
β-strand	31-38	8	5
β-strand	44-52	9	5
α-helix	53	1
α-helix	54-67	14
α-helix	69-71	3
α-helix	78-80	3
β-strand	81	1	5
β-strand	84-92	9	5
β-strand	95-101	7	5
α-helix	107-111	5
α-helix	116-141	26

Chain D: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	66	1	5
β-strand	73-78	6	6
α-helix	86-93	8
α-helix	94-96	3
β-strand	99-103	5	6
α-helix	105	1
β-strand	106	1	7
α-helix	107	1
β-strand	113	1	7
α-helix	114	1
β-strand	116-121	6	6
α-helix	124-134	11
β-strand	138	1	8
β-strand	143	1	8
β-strand	145-148	4	6
β-strand	150-151	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mago nashi protein homolog	A, C	protein	144	Homo sapiens	P61326 (AlphaFold model)
RNA-binding protein 8A	B, D	protein	106	Homo sapiens	Q9Y5S9 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1P27_1 Mago nashi protein homolog (chains A, C)
ESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELK
RIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRV
FYYLVQDLKCLVFSLIGLHFKIKP

Sequence of entity 2 (B, D), FASTA

>1P27_2 RNA-binding protein 8A (chains B, D)
MREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRR
TGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPP

Primary citation

Structure of the y14-magoh core of the exon junction complex. Lau, C.K., Diem, M.D., Dreyfuss, G. et al. Curr Biol (2003) 13:933-941. DOI 10.1016/S0960-9822(03)00328-2 · PubMed

Other PDB entries of the same protein (UniProt P61326 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J0S 2.21 Å, The crystal structure of the Exon Junction Complex at 2.2 A resolution
2HYI 2.3 Å, Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
3EX7 2.3 Å, The crystal structure of EJC in its transition state
7ZNJ 2.4 Å, Structure of an ALYREF-exon junction complex hexamer
8C6J 2.8 Å, Human spliceosomal PM5 C* complex
9XTT 2.92 Å, Human minor spliceosome branching-completed C complex (after step-I)
9XU3 3.0 Å, Human minor spliceosome exon-ligation-ready C* complex (prior to step-II)
2J0Q 3.2 Å, The crystal structure of the Exon Junction Complex at 3.2 A resolution
9FMD 3.3 Å, Integrative model of the human post-catalytic spliceosome (P-complex)
2XB2 3.4 Å, Crystal structure of the core Mago-Y14-eIF4AIII-Barentsz-UPF3b assembly shows how the…
8I0W 3.4 Å, The cryo-EM structure of human C complex
7W59 3.6 Å, The cryo-EM structure of human pre-C*-I complex

Browse structure collections

About this viewer

MolViewer shows 1P27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.