1P4Q: CITED2 transactivation domain

Solution structure of the CITED2 transactivation domain in complex with the p300 CH1 domain. Determined by solution NMR. Released 1 Jul 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,199
Mol. weight: 17.42 kDa
Ligands: ZN
Released: 1 Jul 2003

Explore 1P4Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P4Q contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-28	9
α-helix	47-49	3

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	111-134	24
α-helix	147-159	13
α-helix	171-183	13
α-helix	192-197	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cbp/p300-interacting transactivator 2	A	protein	52	Homo sapiens	Q99967 (AlphaFold model)
E1A-associated protein p300	B	protein	101	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1P4Q_1 Cbp/p300-interacting transactivator 2 (chains A)
GSGSGSGSNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDF

Sequence of entity 2 (B), FASTA

>1P4Q_2 E1A-associated protein p300 (chains B)
MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHC
QSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis for negative regulation of hypoxia-inducible factor-1alpha by CITED2. Freedman, S.J., Sun, Z.Y., Kung, A.L. et al. Nat Struct Biol (2003) 10:504-512. DOI 10.1038/nsb936 · PubMed

Other PDB entries of the same protein (UniProt Q99967 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
1R8U NMR structure of CBP TAZ1/CITED2 complex

Browse structure collections

About this viewer

MolViewer shows 1P4Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.